BLASTX nr result
ID: Panax25_contig00030087
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00030087 (383 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016574632.1 PREDICTED: UTP:RNA uridylyltransferase 1 isoform ... 69 3e-11 XP_015062211.1 PREDICTED: UTP:RNA uridylyltransferase 1 [Solanum... 69 3e-11 XP_016574627.1 PREDICTED: UTP:RNA uridylyltransferase 1 isoform ... 69 3e-11 XP_004229872.1 PREDICTED: UTP:RNA uridylyltransferase 1 [Solanum... 69 3e-11 KCW78240.1 hypothetical protein EUGRSUZ_D02429 [Eucalyptus grandis] 65 4e-11 XP_015167051.1 PREDICTED: UTP:RNA uridylyltransferase 1 [Solanum... 68 1e-10 XP_010106745.1 Poly(A) RNA polymerase cid11 [Morus notabilis] EX... 67 2e-10 XP_006375317.1 hypothetical protein POPTR_0014s06920g, partial [... 66 2e-10 GAU40931.1 hypothetical protein TSUD_348680 [Trifolium subterran... 67 3e-10 EEF50424.1 poly(A) polymerase cid, putative [Ricinus communis] 67 3e-10 XP_015584508.1 PREDICTED: LOW QUALITY PROTEIN: UTP:RNA uridylylt... 67 3e-10 XP_006490961.1 PREDICTED: UTP:RNA uridylyltransferase 1 [Citrus ... 66 4e-10 XP_006445207.1 hypothetical protein CICLE_v10023615mg, partial [... 66 4e-10 XP_007051991.2 PREDICTED: UTP:RNA uridylyltransferase 1 [Theobro... 66 5e-10 XP_015899318.1 PREDICTED: UTP:RNA uridylyltransferase 1 [Ziziphu... 66 5e-10 XP_019238250.1 PREDICTED: UTP:RNA uridylyltransferase 1 [Nicotia... 66 5e-10 XP_016436229.1 PREDICTED: UTP:RNA uridylyltransferase 1-like [Ni... 66 5e-10 XP_016457054.1 PREDICTED: UTP:RNA uridylyltransferase 1-like [Ni... 66 5e-10 XP_009799247.1 PREDICTED: terminal uridylyltransferase 7 [Nicoti... 66 5e-10 XP_009626263.1 PREDICTED: UTP:RNA uridylyltransferase 1 [Nicotia... 66 5e-10 >XP_016574632.1 PREDICTED: UTP:RNA uridylyltransferase 1 isoform X3 [Capsicum annuum] Length = 646 Score = 69.3 bits (168), Expect = 3e-11 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 +SH+LGR VD F++ L+ EF+RAAEIMQYDPNPCVKLFEP Sbjct: 602 VSHDLGRVVDKFSIRVLREEFERAAEIMQYDPNPCVKLFEP 642 >XP_015062211.1 PREDICTED: UTP:RNA uridylyltransferase 1 [Solanum pennellii] Length = 767 Score = 69.3 bits (168), Expect = 3e-11 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 +SH+LGR VD F++ L+ EF+RAAEIMQYDPNPCVKLFEP Sbjct: 723 VSHDLGRVVDKFSIRVLREEFERAAEIMQYDPNPCVKLFEP 763 >XP_016574627.1 PREDICTED: UTP:RNA uridylyltransferase 1 isoform X1 [Capsicum annuum] Length = 769 Score = 69.3 bits (168), Expect = 3e-11 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 +SH+LGR VD F++ L+ EF+RAAEIMQYDPNPCVKLFEP Sbjct: 725 VSHDLGRVVDKFSIRVLREEFERAAEIMQYDPNPCVKLFEP 765 >XP_004229872.1 PREDICTED: UTP:RNA uridylyltransferase 1 [Solanum lycopersicum] Length = 775 Score = 69.3 bits (168), Expect = 3e-11 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 +SH+LGR VD F++ L+ EF+RAAEIMQYDPNPCVKLFEP Sbjct: 731 VSHDLGRVVDKFSIRVLREEFERAAEIMQYDPNPCVKLFEP 771 >KCW78240.1 hypothetical protein EUGRSUZ_D02429 [Eucalyptus grandis] Length = 134 Score = 65.5 bits (158), Expect = 4e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 +SH+LGR VD F++ L+ EF+RAAEIMQYDPNPCV LF+P Sbjct: 90 VSHDLGRVVDKFSIKVLREEFERAAEIMQYDPNPCVTLFKP 130 >XP_015167051.1 PREDICTED: UTP:RNA uridylyltransferase 1 [Solanum tuberosum] Length = 780 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 +SH+LGR VD F++ L+ EF+RAAEI+QYDPNPCVKLFEP Sbjct: 736 VSHDLGRVVDKFSIRVLREEFERAAEIIQYDPNPCVKLFEP 776 >XP_010106745.1 Poly(A) RNA polymerase cid11 [Morus notabilis] EXC11712.1 Poly(A) RNA polymerase cid11 [Morus notabilis] Length = 703 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 ISH+LGR VD ++ L+ EF+RAAEIMQYDPNPCVKLFEP Sbjct: 659 ISHDLGRVVDKHSIRVLREEFERAAEIMQYDPNPCVKLFEP 699 >XP_006375317.1 hypothetical protein POPTR_0014s06920g, partial [Populus trichocarpa] ERP53114.1 hypothetical protein POPTR_0014s06920g, partial [Populus trichocarpa] Length = 318 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 ISH+LGR VD F++ L+ EF+RAA+IMQYDPNPCV LFEP Sbjct: 258 ISHDLGRVVDKFSIKVLREEFERAADIMQYDPNPCVTLFEP 298 >GAU40931.1 hypothetical protein TSUD_348680 [Trifolium subterraneum] Length = 639 Score = 66.6 bits (161), Expect = 3e-10 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP*LR 252 ISH+LGR VD ++ L+ EF+RAA+IMQYDPNPCVKLFEP +R Sbjct: 594 ISHDLGRVVDKHSIKVLREEFERAADIMQYDPNPCVKLFEPYVR 637 >EEF50424.1 poly(A) polymerase cid, putative [Ricinus communis] Length = 696 Score = 66.6 bits (161), Expect = 3e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 ISH+LGR VD +++ L+ EF+RAA IMQYDPNPCVKLFEP Sbjct: 652 ISHDLGRVVDKYSIKVLREEFERAANIMQYDPNPCVKLFEP 692 >XP_015584508.1 PREDICTED: LOW QUALITY PROTEIN: UTP:RNA uridylyltransferase 1 [Ricinus communis] Length = 740 Score = 66.6 bits (161), Expect = 3e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 ISH+LGR VD +++ L+ EF+RAA IMQYDPNPCVKLFEP Sbjct: 696 ISHDLGRVVDKYSIKVLREEFERAANIMQYDPNPCVKLFEP 736 >XP_006490961.1 PREDICTED: UTP:RNA uridylyltransferase 1 [Citrus sinensis] KDO85913.1 hypothetical protein CISIN_1g005380mg [Citrus sinensis] Length = 699 Score = 66.2 bits (160), Expect = 4e-10 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 ++H+LGR VD F++ L+ EF+RAAEIMQ+DPNPCVKLFEP Sbjct: 655 VTHDLGRVVDKFSIKVLREEFERAAEIMQHDPNPCVKLFEP 695 >XP_006445207.1 hypothetical protein CICLE_v10023615mg, partial [Citrus clementina] ESR58447.1 hypothetical protein CICLE_v10023615mg, partial [Citrus clementina] Length = 1046 Score = 66.2 bits (160), Expect = 4e-10 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 ++H+LGR VD F++ L+ EF+RAAEIMQ+DPNPCVKLFEP Sbjct: 686 VTHDLGRVVDKFSIKVLREEFERAAEIMQHDPNPCVKLFEP 726 >XP_007051991.2 PREDICTED: UTP:RNA uridylyltransferase 1 [Theobroma cacao] Length = 722 Score = 65.9 bits (159), Expect = 5e-10 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 ISH+LGR VD F++ L+ EF+RAA++MQYDPNPCV LFEP Sbjct: 678 ISHDLGRVVDKFSIRVLREEFERAADVMQYDPNPCVTLFEP 718 >XP_015899318.1 PREDICTED: UTP:RNA uridylyltransferase 1 [Ziziphus jujuba] Length = 737 Score = 65.9 bits (159), Expect = 5e-10 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 +SH+LGR VD +++ L+ EF+RAA+I+QYDPNPCVKLFEP Sbjct: 693 VSHDLGRVVDKYSIKVLREEFERAADILQYDPNPCVKLFEP 733 >XP_019238250.1 PREDICTED: UTP:RNA uridylyltransferase 1 [Nicotiana attenuata] OIT21863.1 utp:rna uridylyltransferase 1 [Nicotiana attenuata] Length = 766 Score = 65.9 bits (159), Expect = 5e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 +SH+LGR VD F++ L+ EF+RAAEIMQ DPNPCVKLFEP Sbjct: 722 VSHDLGRVVDKFSIRVLREEFERAAEIMQCDPNPCVKLFEP 762 >XP_016436229.1 PREDICTED: UTP:RNA uridylyltransferase 1-like [Nicotiana tabacum] Length = 766 Score = 65.9 bits (159), Expect = 5e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 +SH+LGR VD F++ L+ EF+RAAEIMQ DPNPCVKLFEP Sbjct: 722 VSHDLGRVVDKFSIRVLREEFERAAEIMQCDPNPCVKLFEP 762 >XP_016457054.1 PREDICTED: UTP:RNA uridylyltransferase 1-like [Nicotiana tabacum] Length = 766 Score = 65.9 bits (159), Expect = 5e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 +SH+LGR VD F++ L+ EF+RAAEIMQ DPNPCVKLFEP Sbjct: 722 VSHDLGRVVDKFSIRVLREEFERAAEIMQCDPNPCVKLFEP 762 >XP_009799247.1 PREDICTED: terminal uridylyltransferase 7 [Nicotiana sylvestris] Length = 766 Score = 65.9 bits (159), Expect = 5e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 +SH+LGR VD F++ L+ EF+RAAEIMQ DPNPCVKLFEP Sbjct: 722 VSHDLGRVVDKFSIRVLREEFERAAEIMQCDPNPCVKLFEP 762 >XP_009626263.1 PREDICTED: UTP:RNA uridylyltransferase 1 [Nicotiana tomentosiformis] Length = 766 Score = 65.9 bits (159), Expect = 5e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 383 ISHNLGRSVDAFNLGFLKREFQRAAEIMQYDPNPCVKLFEP 261 +SH+LGR VD F++ L+ EF+RAAEIMQ DPNPCVKLFEP Sbjct: 722 VSHDLGRVVDKFSIRVLREEFERAAEIMQCDPNPCVKLFEP 762