BLASTX nr result
ID: Panax25_contig00029894
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00029894 (778 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM85241.1 hypothetical protein DCAR_027337 [Daucus carota subsp... 57 4e-07 XP_017220491.1 PREDICTED: uncharacterized protein LOC108197394 [... 57 6e-07 >KZM85241.1 hypothetical protein DCAR_027337 [Daucus carota subsp. sativus] Length = 84 Score = 56.6 bits (135), Expect = 4e-07 Identities = 31/63 (49%), Positives = 47/63 (74%), Gaps = 2/63 (3%) Frame = +3 Query: 573 MDKHGNDYNGEKIDVKSKPL-TDVDSQNILLNGEAEKD-DETASLLPPRIGGGLSRKLDQ 746 MD +G DY +K DVKS+ L +DV+S+ LL+G+ ++D DET +LL P GGLSRK+++ Sbjct: 1 MDSNGKDYGCDKNDVKSEALLSDVESKTSLLDGDRKEDEDETTTLLVPPRRGGLSRKVEK 60 Query: 747 SRK 755 S++ Sbjct: 61 SQR 63 >XP_017220491.1 PREDICTED: uncharacterized protein LOC108197394 [Daucus carota subsp. sativus] Length = 102 Score = 56.6 bits (135), Expect = 6e-07 Identities = 31/63 (49%), Positives = 47/63 (74%), Gaps = 2/63 (3%) Frame = +3 Query: 573 MDKHGNDYNGEKIDVKSKPL-TDVDSQNILLNGEAEKD-DETASLLPPRIGGGLSRKLDQ 746 MD +G DY +K DVKS+ L +DV+S+ LL+G+ ++D DET +LL P GGLSRK+++ Sbjct: 1 MDSNGKDYGCDKNDVKSEALLSDVESKTSLLDGDRKEDEDETTTLLVPPRRGGLSRKVEK 60 Query: 747 SRK 755 S++ Sbjct: 61 SQR 63