BLASTX nr result
ID: Panax25_contig00029893
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00029893 (612 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM85241.1 hypothetical protein DCAR_027337 [Daucus carota subsp... 52 8e-06 >KZM85241.1 hypothetical protein DCAR_027337 [Daucus carota subsp. sativus] Length = 84 Score = 52.4 bits (124), Expect = 8e-06 Identities = 29/64 (45%), Positives = 46/64 (71%), Gaps = 2/64 (3%) Frame = -2 Query: 188 MDKHGNNYNGEKFDVKSKPL-TDVDSQNILLNGEGEKD-DETASLLPPRIGGGLSRKLDQ 15 MD +G +Y +K DVKS+ L +DV+S+ LL+G+ ++D DET +LL P GGLSRK+++ Sbjct: 1 MDSNGKDYGCDKNDVKSEALLSDVESKTSLLDGDRKEDEDETTTLLVPPRRGGLSRKVEK 60 Query: 14 KPQR 3 ++ Sbjct: 61 SQRK 64