BLASTX nr result
ID: Panax25_contig00029840
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00029840 (521 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVH94089.1 hypothetical protein Ccrd_003838 [Cynara cardunculus ... 70 4e-12 XP_017256954.1 PREDICTED: preprotein translocase subunit SECE1 [... 68 3e-11 XP_010649905.1 PREDICTED: preprotein translocase subunit SECE1 [... 65 4e-10 CDO99065.1 unnamed protein product [Coffea canephora] 64 2e-09 AFK42332.1 unknown [Medicago truncatula] 63 2e-09 AFK44629.1 unknown [Lotus japonicus] 62 5e-09 XP_003613597.1 SecE/sec61-gamma subunit of protein translocation... 62 7e-09 XP_016453176.1 PREDICTED: preprotein translocase subunit SECE1-l... 62 8e-09 XP_009784387.1 PREDICTED: preprotein translocase subunit SECE1 [... 62 8e-09 XP_011016618.1 PREDICTED: preprotein translocase subunit SECE1 [... 62 9e-09 XP_002312532.1 hypothetical protein POPTR_0008s15330g [Populus t... 62 9e-09 KCW84220.1 hypothetical protein EUGRSUZ_B01085 [Eucalyptus grandis] 60 1e-08 KNA15615.1 hypothetical protein SOVF_096630 [Spinacia oleracea] 60 3e-08 XP_010275832.1 PREDICTED: preprotein translocase subunit SECE1 [... 60 3e-08 XP_004490005.1 PREDICTED: preprotein translocase subunit SECE1 [... 60 3e-08 XP_018722764.1 PREDICTED: preprotein translocase subunit SECE1 [... 60 4e-08 KCW45128.1 hypothetical protein EUGRSUZ_L01274 [Eucalyptus grandis] 60 4e-08 XP_006360788.1 PREDICTED: preprotein translocase subunit SECE1 [... 60 5e-08 XP_019267380.1 PREDICTED: preprotein translocase subunit SECE1 [... 60 6e-08 XP_016453175.1 PREDICTED: preprotein translocase subunit SECE1-l... 60 6e-08 >KVH94089.1 hypothetical protein Ccrd_003838 [Cynara cardunculus var. scolymus] Length = 167 Score = 70.5 bits (171), Expect = 4e-12 Identities = 38/67 (56%), Positives = 44/67 (65%), Gaps = 3/67 (4%) Frame = -2 Query: 517 SSTQQK---EDELSELGSEIKKAMKERESKGGENFWSGVGEEIGEIEWPPFNKXXXXXXX 347 S T QK ++ELSELG+EIKKAM ERE + E+ W GV EEIG+IEWP FNK Sbjct: 71 SETTQKPPSDEELSELGTEIKKAMMEREIRKDESIWGGVAEEIGQIEWPAFNKVIGTTGV 130 Query: 346 XXXVIAG 326 VIAG Sbjct: 131 VLGVIAG 137 >XP_017256954.1 PREDICTED: preprotein translocase subunit SECE1 [Daucus carota subsp. sativus] KZN09729.1 hypothetical protein DCAR_002385 [Daucus carota subsp. sativus] Length = 169 Score = 68.2 bits (165), Expect = 3e-11 Identities = 35/63 (55%), Positives = 43/63 (68%), Gaps = 2/63 (3%) Frame = -2 Query: 508 QQKEDELSELGSEIKKAMKERESKGGEN--FWSGVGEEIGEIEWPPFNKXXXXXXXXXXV 335 + + D+LSE+G+EIKKAMKER+ E+ FW GVGEEIGEIEWP F+K V Sbjct: 77 EPESDQLSEIGAEIKKAMKERDESKQESDDFWKGVGEEIGEIEWPAFSKVVSTTGVVLGV 136 Query: 334 IAG 326 IAG Sbjct: 137 IAG 139 >XP_010649905.1 PREDICTED: preprotein translocase subunit SECE1 [Vitis vinifera] Length = 168 Score = 65.1 bits (157), Expect = 4e-10 Identities = 36/57 (63%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -2 Query: 493 ELSELGSEIKKAMKERESKGGE-NFWSGVGEEIGEIEWPPFNKXXXXXXXXXXVIAG 326 +LSELGSEIKK MKERE G E +FWSGV EEI EIEWP F K VIAG Sbjct: 82 KLSELGSEIKKTMKEREETGKEADFWSGVAEEIREIEWPAFGKVLGTTWVVLGVIAG 138 >CDO99065.1 unnamed protein product [Coffea canephora] Length = 186 Score = 63.9 bits (154), Expect = 2e-09 Identities = 32/57 (56%), Positives = 38/57 (66%) Frame = -2 Query: 496 DELSELGSEIKKAMKERESKGGENFWSGVGEEIGEIEWPPFNKXXXXXXXXXXVIAG 326 DE+S+LG+EIKKAM+ER K + WSGV EE+ EIEWP FNK VIAG Sbjct: 100 DEVSQLGAEIKKAMQERAEKEQDFLWSGVAEEVKEIEWPAFNKVLGTTGVVLAVIAG 156 >AFK42332.1 unknown [Medicago truncatula] Length = 159 Score = 63.2 bits (152), Expect = 2e-09 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -2 Query: 487 SELGSEIKKAMKERESKGGENFWSGVGEEIGEIEWPPFNK 368 SEL SE+KKAM+ERE + G NFW+GV EIGEIEWP F K Sbjct: 76 SELASELKKAMQEREEQEGNNFWNGVVSEIGEIEWPEFGK 115 >AFK44629.1 unknown [Lotus japonicus] Length = 161 Score = 62.0 bits (149), Expect = 5e-09 Identities = 28/41 (68%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -2 Query: 487 SELGSEIKKAMKERESK-GGENFWSGVGEEIGEIEWPPFNK 368 SEL SE+KKAM+ER+ K GG+NFW+GV +EI EIEWP F K Sbjct: 77 SELASELKKAMQERKDKEGGDNFWNGVAQEINEIEWPAFGK 117 >XP_003613597.1 SecE/sec61-gamma subunit of protein translocation complex protein [Medicago truncatula] AES96555.1 SecE/sec61-gamma subunit of protein translocation complex protein [Medicago truncatula] Length = 159 Score = 61.6 bits (148), Expect = 7e-09 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -2 Query: 487 SELGSEIKKAMKERESKGGENFWSGVGEEIGEIEWPPFNK 368 SEL SE+KKAM+ER+ + G NFW+GV EIGEIEWP F K Sbjct: 76 SELASELKKAMQERKEQEGNNFWNGVVSEIGEIEWPEFGK 115 >XP_016453176.1 PREDICTED: preprotein translocase subunit SECE1-like isoform X2 [Nicotiana tabacum] Length = 181 Score = 62.0 bits (149), Expect = 8e-09 Identities = 36/59 (61%), Positives = 39/59 (66%), Gaps = 2/59 (3%) Frame = -2 Query: 496 DELS--ELGSEIKKAMKERESKGGENFWSGVGEEIGEIEWPPFNKXXXXXXXXXXVIAG 326 DELS ++GSEIKK MKERE KG + FWSGV EEI EIEWP F K VIAG Sbjct: 94 DELSPSDVGSEIKKLMKEREEKGTD-FWSGVAEEIREIEWPAFGKVLSTTGVVIGVIAG 151 >XP_009784387.1 PREDICTED: preprotein translocase subunit SECE1 [Nicotiana sylvestris] XP_016480368.1 PREDICTED: preprotein translocase subunit SECE1-like [Nicotiana tabacum] Length = 181 Score = 62.0 bits (149), Expect = 8e-09 Identities = 36/59 (61%), Positives = 39/59 (66%), Gaps = 2/59 (3%) Frame = -2 Query: 496 DELS--ELGSEIKKAMKERESKGGENFWSGVGEEIGEIEWPPFNKXXXXXXXXXXVIAG 326 DELS ++GSEIKK MKERE KG + FWSGV EEI EIEWP F K VIAG Sbjct: 94 DELSPSDVGSEIKKLMKEREEKGTD-FWSGVAEEIREIEWPAFGKVLSTTGVVIGVIAG 151 >XP_011016618.1 PREDICTED: preprotein translocase subunit SECE1 [Populus euphratica] Length = 172 Score = 61.6 bits (148), Expect = 9e-09 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -2 Query: 484 ELGSEIKKAMKERESKGGENFWSGVGEEIGEIEWPPFNK 368 ELG+EIKKAM ER+SK NFWSGV EEI EIEWP F K Sbjct: 90 ELGAEIKKAMMERKSKEEGNFWSGVAEEIQEIEWPAFGK 128 >XP_002312532.1 hypothetical protein POPTR_0008s15330g [Populus trichocarpa] EEE89899.1 hypothetical protein POPTR_0008s15330g [Populus trichocarpa] Length = 172 Score = 61.6 bits (148), Expect = 9e-09 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -2 Query: 484 ELGSEIKKAMKERESKGGENFWSGVGEEIGEIEWPPFNK 368 ELG+EIKKAM ER+SK NFWSGV EEI EIEWP F K Sbjct: 90 ELGAEIKKAMMERKSKEEGNFWSGVAEEIQEIEWPAFGK 128 >KCW84220.1 hypothetical protein EUGRSUZ_B01085 [Eucalyptus grandis] Length = 143 Score = 60.5 bits (145), Expect = 1e-08 Identities = 31/56 (55%), Positives = 37/56 (66%) Frame = -2 Query: 493 ELSELGSEIKKAMKERESKGGENFWSGVGEEIGEIEWPPFNKXXXXXXXXXXVIAG 326 EL+ELG+EIKKA+++R+ K N SGV EEIGEIEWP F K VIAG Sbjct: 58 ELTELGTEIKKALEQRKEKADGNLLSGVAEEIGEIEWPTFGKVLGITGVVLGVIAG 113 >KNA15615.1 hypothetical protein SOVF_096630 [Spinacia oleracea] Length = 157 Score = 60.1 bits (144), Expect = 3e-08 Identities = 33/60 (55%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = -2 Query: 502 KEDELSELGSEIKKAMKERES-KGGENFWSGVGEEIGEIEWPPFNKXXXXXXXXXXVIAG 326 +E +LSELG+EIKKAMKER+ K F+SGV +EIG+IEWP F K VIAG Sbjct: 67 EEQQLSELGTEIKKAMKERDKVKEDSGFFSGVVDEIGQIEWPDFGKVVGITGVVLGVIAG 126 >XP_010275832.1 PREDICTED: preprotein translocase subunit SECE1 [Nelumbo nucifera] Length = 183 Score = 60.5 bits (145), Expect = 3e-08 Identities = 34/59 (57%), Positives = 37/59 (62%), Gaps = 4/59 (6%) Frame = -2 Query: 490 LSELGSEIKKAMKER----ESKGGENFWSGVGEEIGEIEWPPFNKXXXXXXXXXXVIAG 326 LSELGSEIK+AMK R ES GG + WSGV EE+ EIEWP F K VIAG Sbjct: 95 LSELGSEIKEAMKTRKEREESSGGGDLWSGVAEEVREIEWPVFGKVLGTTGVVLGVIAG 153 >XP_004490005.1 PREDICTED: preprotein translocase subunit SECE1 [Cicer arietinum] Length = 167 Score = 60.1 bits (144), Expect = 3e-08 Identities = 28/47 (59%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = -2 Query: 505 QKEDELSELGSEIKKAMKERESK-GGENFWSGVGEEIGEIEWPPFNK 368 + E S+L SE+KKAM+ER+ K GG+N W+GV EIGEIEWP F K Sbjct: 77 EPEPSQSDLASELKKAMQERKDKEGGDNLWNGVVSEIGEIEWPEFGK 123 >XP_018722764.1 PREDICTED: preprotein translocase subunit SECE1 [Eucalyptus grandis] KCW44095.1 hypothetical protein EUGRSUZ_L02493 [Eucalyptus grandis] Length = 196 Score = 60.5 bits (145), Expect = 4e-08 Identities = 31/56 (55%), Positives = 37/56 (66%) Frame = -2 Query: 493 ELSELGSEIKKAMKERESKGGENFWSGVGEEIGEIEWPPFNKXXXXXXXXXXVIAG 326 EL+ELG+EIKKA+++R+ K N SGV EEIGEIEWP F K VIAG Sbjct: 111 ELTELGTEIKKALEQRKEKADGNLLSGVAEEIGEIEWPTFGKVLGITGVVLGVIAG 166 >KCW45128.1 hypothetical protein EUGRSUZ_L01274 [Eucalyptus grandis] Length = 204 Score = 60.5 bits (145), Expect = 4e-08 Identities = 31/56 (55%), Positives = 37/56 (66%) Frame = -2 Query: 493 ELSELGSEIKKAMKERESKGGENFWSGVGEEIGEIEWPPFNKXXXXXXXXXXVIAG 326 EL+ELG+EIKKA+++R+ K N SGV EEIGEIEWP F K VIAG Sbjct: 119 ELTELGTEIKKALEQRKEKADGNLLSGVAEEIGEIEWPTFGKVLGITGVVLGVIAG 174 >XP_006360788.1 PREDICTED: preprotein translocase subunit SECE1 [Solanum tuberosum] Length = 179 Score = 59.7 bits (143), Expect = 5e-08 Identities = 32/58 (55%), Positives = 38/58 (65%) Frame = -2 Query: 499 EDELSELGSEIKKAMKERESKGGENFWSGVGEEIGEIEWPPFNKXXXXXXXXXXVIAG 326 ++ LS++GSE+KK MKERE K + FWSGV EEI EIEWP F K VIAG Sbjct: 93 DEVLSDVGSELKKLMKEREQKEPD-FWSGVAEEIREIEWPAFGKVLSTTGVVIGVIAG 149 >XP_019267380.1 PREDICTED: preprotein translocase subunit SECE1 [Nicotiana attenuata] OIT34418.1 preprotein translocase subunit sece1 [Nicotiana attenuata] Length = 181 Score = 59.7 bits (143), Expect = 6e-08 Identities = 35/59 (59%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Frame = -2 Query: 496 DELS--ELGSEIKKAMKERESKGGENFWSGVGEEIGEIEWPPFNKXXXXXXXXXXVIAG 326 DELS ++GSEIKK MKERE KG + WSGV EEI EIEWP F K VIAG Sbjct: 94 DELSPSDVGSEIKKLMKEREEKGTD-LWSGVAEEIREIEWPAFGKVLSTTGVVIGVIAG 151 >XP_016453175.1 PREDICTED: preprotein translocase subunit SECE1-like isoform X1 [Nicotiana tabacum] Length = 181 Score = 59.7 bits (143), Expect = 6e-08 Identities = 35/59 (59%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Frame = -2 Query: 496 DELS--ELGSEIKKAMKERESKGGENFWSGVGEEIGEIEWPPFNKXXXXXXXXXXVIAG 326 DELS ++GSEIKK MKERE KG + WSGV EEI EIEWP F K VIAG Sbjct: 94 DELSPSDVGSEIKKLMKEREEKGTD-LWSGVAEEIREIEWPAFGKVLSTTGVVIGVIAG 151