BLASTX nr result
ID: Panax25_contig00029836
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00029836 (543 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017219622.1 PREDICTED: BTB/POZ domain-containing protein At3g... 83 3e-15 XP_016477560.1 PREDICTED: BTB/POZ domain-containing protein At3g... 82 4e-15 XP_016477558.1 PREDICTED: BTB/POZ domain-containing protein At3g... 82 4e-15 XP_016477557.1 PREDICTED: BTB/POZ domain-containing protein At3g... 82 4e-15 XP_009629328.1 PREDICTED: BTB/POZ domain-containing protein At3g... 82 4e-15 XP_016494291.1 PREDICTED: BTB/POZ domain-containing protein At3g... 82 6e-15 XP_009776607.1 PREDICTED: BTB/POZ domain-containing protein At3g... 82 6e-15 XP_006425769.1 hypothetical protein CICLE_v10026330mg [Citrus cl... 79 1e-14 XP_019246022.1 PREDICTED: BTB/POZ domain-containing protein At3g... 81 1e-14 XP_008808898.1 PREDICTED: BTB/POZ domain-containing protein At3g... 81 1e-14 XP_017242274.1 PREDICTED: BTB/POZ domain-containing protein At3g... 81 1e-14 XP_012079112.1 PREDICTED: BTB/POZ domain-containing protein At3g... 81 1e-14 KDO79429.1 hypothetical protein CISIN_1g014635mg [Citrus sinensis] 79 3e-14 XP_018826450.1 PREDICTED: BTB/POZ domain-containing protein At3g... 80 4e-14 KDO79424.1 hypothetical protein CISIN_1g014635mg [Citrus sinensi... 79 4e-14 OAY33901.1 hypothetical protein MANES_13G134400 [Manihot esculenta] 79 5e-14 XP_006466699.1 PREDICTED: BTB/POZ domain-containing protein At3g... 79 5e-14 OMO84211.1 hypothetical protein COLO4_22161 [Corchorus olitorius] 79 7e-14 OMO56822.1 hypothetical protein CCACVL1_26245 [Corchorus capsula... 79 7e-14 XP_006338266.1 PREDICTED: BTB/POZ domain-containing protein At3g... 79 9e-14 >XP_017219622.1 PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Daucus carota subsp. sativus] KZM88587.1 hypothetical protein DCAR_025662 [Daucus carota subsp. sativus] Length = 527 Score = 82.8 bits (203), Expect = 3e-15 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPHEEHGNLFQPDS 418 WLGSFLK+GDNCPNLQRAFEVWWRRSFIRPH E N+ Q DS Sbjct: 486 WLGSFLKTGDNCPNLQRAFEVWWRRSFIRPHVESANVIQSDS 527 >XP_016477560.1 PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform X3 [Nicotiana tabacum] Length = 527 Score = 82.4 bits (202), Expect = 4e-15 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPHEEHGNLFQPDSLLT 409 WLGSFLK+GDNCPNLQRAFEVWWRR+F+RP+ E GN+ Q D L+T Sbjct: 477 WLGSFLKAGDNCPNLQRAFEVWWRRTFVRPYAESGNIRQLDHLMT 521 >XP_016477558.1 PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform X2 [Nicotiana tabacum] XP_016477559.1 PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform X2 [Nicotiana tabacum] Length = 536 Score = 82.4 bits (202), Expect = 4e-15 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPHEEHGNLFQPDSLLT 409 WLGSFLK+GDNCPNLQRAFEVWWRR+F+RP+ E GN+ Q D L+T Sbjct: 486 WLGSFLKAGDNCPNLQRAFEVWWRRTFVRPYAESGNIRQLDHLMT 530 >XP_016477557.1 PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform X1 [Nicotiana tabacum] Length = 536 Score = 82.4 bits (202), Expect = 4e-15 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPHEEHGNLFQPDSLLT 409 WLGSFLK+GDNCPNLQRAFEVWWRR+F+RP+ E GN+ Q D L+T Sbjct: 486 WLGSFLKAGDNCPNLQRAFEVWWRRTFVRPYAESGNIRQLDHLMT 530 >XP_009629328.1 PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana tomentosiformis] XP_009629329.1 PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana tomentosiformis] Length = 538 Score = 82.4 bits (202), Expect = 4e-15 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPHEEHGNLFQPDSLLT 409 WLGSFLK+GDNCPNLQRAFEVWWRR+F+RP+ E GN+ Q D L+T Sbjct: 488 WLGSFLKAGDNCPNLQRAFEVWWRRTFVRPYAESGNIRQLDHLMT 532 >XP_016494291.1 PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Nicotiana tabacum] XP_016494292.1 PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Nicotiana tabacum] Length = 536 Score = 82.0 bits (201), Expect = 6e-15 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPHEEHGNLFQPDSLLT 409 WLGSFLKSGDNCPNLQRAFEVWWRR+F+RP+ E GN Q D L+T Sbjct: 486 WLGSFLKSGDNCPNLQRAFEVWWRRTFVRPYAESGNTRQLDHLVT 530 >XP_009776607.1 PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana sylvestris] XP_009776608.1 PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana sylvestris] Length = 536 Score = 82.0 bits (201), Expect = 6e-15 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPHEEHGNLFQPDSLLT 409 WLGSFLKSGDNCPNLQRAFEVWWRR+F+RP+ E GN Q D L+T Sbjct: 486 WLGSFLKSGDNCPNLQRAFEVWWRRTFVRPYAESGNTRQLDHLVT 530 >XP_006425769.1 hypothetical protein CICLE_v10026330mg [Citrus clementina] ESR39009.1 hypothetical protein CICLE_v10026330mg [Citrus clementina] Length = 254 Score = 79.3 bits (194), Expect = 1e-14 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPH-EEHGNLFQPDSLLT 409 WLGSFLK+GDNCPNLQRAFEVWWRR+FIRP+ + GNL Q DS +T Sbjct: 206 WLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYVDAQGNLVQSDSSMT 251 >XP_019246022.1 PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana attenuata] OIT03672.1 btbpoz domain-containing protein [Nicotiana attenuata] Length = 536 Score = 81.3 bits (199), Expect = 1e-14 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPHEEHGNLFQPDSLLT 409 WLGSFLK+GDNCPNLQRAFEVWWRR+F+RP+ E GN+ Q D ++T Sbjct: 486 WLGSFLKAGDNCPNLQRAFEVWWRRTFVRPYAESGNIRQLDHVMT 530 >XP_008808898.1 PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix dactylifera] XP_008808899.1 PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix dactylifera] XP_008808900.1 PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix dactylifera] Length = 528 Score = 80.9 bits (198), Expect = 1e-14 Identities = 37/46 (80%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPH-EEHGNLFQPDSLLT 409 WLGSFLK GDNCPNLQRAFEVWWRR+FIRP+ E+ GNL Q DS LT Sbjct: 483 WLGSFLKVGDNCPNLQRAFEVWWRRTFIRPYVEQQGNLAQSDSKLT 528 >XP_017242274.1 PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Daucus carota subsp. sativus] KZN02202.1 hypothetical protein DCAR_010956 [Daucus carota subsp. sativus] Length = 529 Score = 80.9 bits (198), Expect = 1e-14 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPHEEHGNLFQPDSLLT 409 WL FLK+GD+CPNLQRAFEVWWRRSFIRPH EH NL QP++ T Sbjct: 485 WLSCFLKTGDSCPNLQRAFEVWWRRSFIRPHMEHANLDQPENSST 529 >XP_012079112.1 PREDICTED: BTB/POZ domain-containing protein At3g50780 [Jatropha curcas] KDP31825.1 hypothetical protein JCGZ_12286 [Jatropha curcas] Length = 534 Score = 80.9 bits (198), Expect = 1e-14 Identities = 36/46 (78%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPH-EEHGNLFQPDSLLT 409 WLGSFLK+GDNCPNLQRAFEVWWRR+FIRP+ E GNL Q DS +T Sbjct: 486 WLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYIETQGNLLQSDSSMT 531 >KDO79429.1 hypothetical protein CISIN_1g014635mg [Citrus sinensis] Length = 357 Score = 79.3 bits (194), Expect = 3e-14 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPH-EEHGNLFQPDSLLT 409 WLGSFLK+GDNCPNLQRAFEVWWRR+FIRP+ + GNL Q DS +T Sbjct: 309 WLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYVDAQGNLVQSDSSMT 354 >XP_018826450.1 PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Juglans regia] XP_018826451.1 PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Juglans regia] Length = 537 Score = 79.7 bits (195), Expect = 4e-14 Identities = 36/46 (78%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPH-EEHGNLFQPDSLLT 409 WLGSFLK+GDNCPNLQRAFEVWWRR+FIRP+ E GN FQ DS +T Sbjct: 480 WLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYVETPGNNFQSDSSMT 525 >KDO79424.1 hypothetical protein CISIN_1g014635mg [Citrus sinensis] KDO79425.1 hypothetical protein CISIN_1g014635mg [Citrus sinensis] KDO79426.1 hypothetical protein CISIN_1g014635mg [Citrus sinensis] KDO79427.1 hypothetical protein CISIN_1g014635mg [Citrus sinensis] KDO79428.1 hypothetical protein CISIN_1g014635mg [Citrus sinensis] Length = 421 Score = 79.3 bits (194), Expect = 4e-14 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPH-EEHGNLFQPDSLLT 409 WLGSFLK+GDNCPNLQRAFEVWWRR+FIRP+ + GNL Q DS +T Sbjct: 373 WLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYVDAQGNLVQSDSSMT 418 >OAY33901.1 hypothetical protein MANES_13G134400 [Manihot esculenta] Length = 534 Score = 79.3 bits (194), Expect = 5e-14 Identities = 35/46 (76%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPHEE-HGNLFQPDSLLT 409 WLGSFLK+GDNCPNLQRAFEVWWRR+FIRP+ E GN Q DS +T Sbjct: 486 WLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYSETQGNTLQSDSSMT 531 >XP_006466699.1 PREDICTED: BTB/POZ domain-containing protein At3g50780 [Citrus sinensis] Length = 535 Score = 79.3 bits (194), Expect = 5e-14 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPH-EEHGNLFQPDSLLT 409 WLGSFLK+GDNCPNLQRAFEVWWRR+FIRP+ + GNL Q DS +T Sbjct: 487 WLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYVDAQGNLVQSDSSMT 532 >OMO84211.1 hypothetical protein COLO4_22161 [Corchorus olitorius] Length = 534 Score = 79.0 bits (193), Expect = 7e-14 Identities = 34/46 (73%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPHEE-HGNLFQPDSLLT 409 WLGSFLK+GDNCPNLQRAFEVWWRR+FIRP+ + GN+ Q DS +T Sbjct: 486 WLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYSDTQGNVLQSDSSMT 531 >OMO56822.1 hypothetical protein CCACVL1_26245 [Corchorus capsularis] Length = 534 Score = 79.0 bits (193), Expect = 7e-14 Identities = 34/46 (73%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPHEE-HGNLFQPDSLLT 409 WLGSFLK+GDNCPNLQRAFEVWWRR+FIRP+ + GN+ Q DS +T Sbjct: 486 WLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYSDTQGNVLQSDSSMT 531 >XP_006338266.1 PREDICTED: BTB/POZ domain-containing protein At3g50780 [Solanum tuberosum] Length = 536 Score = 78.6 bits (192), Expect = 9e-14 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -1 Query: 543 WLGSFLKSGDNCPNLQRAFEVWWRRSFIRPHEEHGNLFQPDSLLT 409 WLGSFLKSGDNCPNLQRAFEVWWRR+F+RP+ E GN + D + T Sbjct: 486 WLGSFLKSGDNCPNLQRAFEVWWRRTFVRPYAESGNTRRLDHVTT 530