BLASTX nr result
ID: Panax25_contig00029834
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00029834 (446 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007149604.1 hypothetical protein PHAVU_005G083600g [Phaseolus... 54 3e-06 XP_007161912.1 hypothetical protein PHAVU_001G108100g [Phaseolus... 53 5e-06 ABA39136.1 60S ribosomal protein L12, partial [Gossypium hirsutum] 50 6e-06 >XP_007149604.1 hypothetical protein PHAVU_005G083600g [Phaseolus vulgaris] ESW21598.1 hypothetical protein PHAVU_005G083600g [Phaseolus vulgaris] Length = 150 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 357 MGSTLTVPLKEILRSCVSVGCSVDGHNPYDLQQEISD 247 M L+ +KEILR+CVSVGC+VDG +P DLQQEISD Sbjct: 106 MAKDLSRSIKEILRTCVSVGCTVDGKDPKDLQQEISD 142 >XP_007161912.1 hypothetical protein PHAVU_001G108100g [Phaseolus vulgaris] ESW33906.1 hypothetical protein PHAVU_001G108100g [Phaseolus vulgaris] Length = 150 Score = 53.1 bits (126), Expect = 5e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 357 MGSTLTVPLKEILRSCVSVGCSVDGHNPYDLQQEISD 247 M L+ +KEILR+CVSVGC+VDG +P DLQQEISD Sbjct: 106 MEKDLSRSIKEILRTCVSVGCTVDGKDPKDLQQEISD 142 >ABA39136.1 60S ribosomal protein L12, partial [Gossypium hirsutum] Length = 45 Score = 50.4 bits (119), Expect = 6e-06 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -3 Query: 357 MGSTLTVPLKEILRSCVSVGCSVDGHNPYDLQQEISD 247 M L +KEIL +CVSVGC+VDG +P DLQQEISD Sbjct: 1 MAKDLRETVKEILGTCVSVGCTVDGKDPKDLQQEISD 37