BLASTX nr result
ID: Panax25_contig00029825
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00029825 (1346 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACZ65154.1 Rps3, partial (chloroplast) [Eryngium maritimum] 90 1e-18 CCF70847.1 small ribosomal protein subunit 3, partial (chloropla... 87 8e-18 CCF70823.1 small ribosomal protein subunit 3, partial (chloropla... 86 1e-17 CCF70837.1 small ribosomal protein subunit 3, partial (chloropla... 86 1e-17 CCF70817.1 small ribosomal protein subunit 3, partial (chloropla... 86 1e-17 ANS71807.1 ribosomal protein S3 (chloroplast) [Eleutherococcus s... 92 1e-17 YP_009266557.1 ribosomal protein S3 (chloroplast) [Panax stipule... 92 1e-17 YP_087004.1 ribosomal protein S3 [Panax ginseng] YP_009121212.1 ... 92 1e-17 YP_008815156.1 ribosomal protein S3 (chloroplast) [Schefflera de... 92 1e-17 YP_008814895.1 ribosomal protein S3 (chloroplast) [Aralia undula... 92 1e-17 YP_004935591.1 ribosomal protein S3 (chloroplast) [Eleutherococc... 92 1e-17 ADK89732.1 ribosomal protein S3 (chloroplast) [Hydrocotyle verti... 91 2e-17 CCF70855.1 small ribosomal protein subunit 3, partial (chloropla... 85 3e-17 CCF70825.1 small ribosomal protein subunit 3, partial (chloropla... 85 4e-17 ADX99146.1 ribosomal protein S3, partial (chloroplast) [Citharex... 89 4e-17 KMT04633.1 hypothetical protein BVRB_8g182860 [Beta vulgaris sub... 86 4e-17 CCF70861.1 small ribosomal protein subunit 3, partial (chloropla... 84 5e-17 APU51517.1 ribosomal protein S3 (chloroplast) [Sambucus williamsii] 90 5e-17 YP_009338463.1 ribosomal protein S3 (chloroplast) [Pterygopleuru... 90 5e-17 YP_009338379.1 ribosomal protein S3 (chloroplast) [Peucedanum in... 90 5e-17 >ACZ65154.1 Rps3, partial (chloroplast) [Eryngium maritimum] Length = 67 Score = 89.7 bits (221), Expect = 1e-18 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE 123 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE Sbjct: 27 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE 67 >CCF70847.1 small ribosomal protein subunit 3, partial (chloroplast) [Aextoxicon punctatum] Length = 43 Score = 86.7 bits (213), Expect = 8e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE 123 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFID E Sbjct: 3 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDEE 43 >CCF70823.1 small ribosomal protein subunit 3, partial (chloroplast) [Trochodendron aralioides] Length = 41 Score = 86.3 bits (212), Expect = 1e-17 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE 123 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIF+D E Sbjct: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFVDEE 41 >CCF70837.1 small ribosomal protein subunit 3, partial (chloroplast) [Cercidiphyllum japonicum] Length = 42 Score = 86.3 bits (212), Expect = 1e-17 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE 123 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIF+D E Sbjct: 2 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFVDEE 42 >CCF70817.1 small ribosomal protein subunit 3, partial (chloroplast) [Platanus orientalis] CCF70819.1 small ribosomal protein subunit 3, partial (chloroplast) [Platanus occidentalis] CCF70821.1 small ribosomal protein subunit 3, partial (chloroplast) [Tetracentron sinense] CCF70829.1 small ribosomal protein subunit 3, partial (chloroplast) [Pachysandra terminalis] CCF70831.1 small ribosomal protein subunit 3, partial (chloroplast) [Gunnera tinctoria] CCF70833.1 small ribosomal protein subunit 3, partial (chloroplast) [Myrothamnus flabellifolia] Length = 43 Score = 86.3 bits (212), Expect = 1e-17 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE 123 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIF+D E Sbjct: 3 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFVDEE 43 >ANS71807.1 ribosomal protein S3 (chloroplast) [Eleutherococcus sessiliflorus] Length = 219 Score = 91.7 bits (226), Expect = 1e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE 126 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE Sbjct: 178 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE 219 >YP_009266557.1 ribosomal protein S3 (chloroplast) [Panax stipuleanatus] ANK78369.1 ribosomal protein S3 (chloroplast) [Panax japonicus var. bipinnatifidus] ANK78455.1 ribosomal protein S3 (chloroplast) [Panax stipuleanatus] Length = 219 Score = 91.7 bits (226), Expect = 1e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE 126 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE Sbjct: 178 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE 219 >YP_087004.1 ribosomal protein S3 [Panax ginseng] YP_009121212.1 ribosomal protein S3 (chloroplast) [Panax notoginseng] YP_009155466.1 ribosomal protein S3 (chloroplast) [Panax quinquefolius] YP_009191891.1 ribosomal protein S3 (chloroplast) [Panax japonicus] YP_009191978.1 ribosomal protein S3 (chloroplast) [Panax vietnamensis] Q68RW8.1 RecName: Full=30S ribosomal protein S3, chloroplastic AAT98547.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AGM15026.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AGM15112.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AGM15198.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AGW31958.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AHJ81028.1 ribosomal protein S3 (mitochondrion) [Panax ginseng] AIA24366.1 ribosomal protein S3 (chloroplast) [Panax notoginseng] AIX97927.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AIX98014.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AIX98097.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AIX98182.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AIX98267.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AIX98352.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AIX98437.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AIX98522.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AIX98607.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AJC99526.1 ribosomal protein S3 (chloroplast) [Panax quinquefolius] AJC99611.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AJC99696.1 ribosomal protein S3 (chloroplast) [Panax ginseng] AKB99110.1 ribosomal protein S3 (chloroplast) [Panax notoginseng] AKB99197.1 ribosomal protein S3 (chloroplast) [Panax japonicus] AKB99284.1 ribosomal protein S3 (chloroplast) [Panax vietnamensis] AKB99371.1 ribosomal protein S3 (chloroplast) [Panax vietnamensis] AKG26639.1 ribosomal protein S3 (chloroplast) [Panax notoginseng] AKU70815.1 ribosomal protein S3 (chloroplast) [Panax notoginseng] AKZ29786.1 ribosomal protein S3 (chloroplast) [Panax quinquefolius] AMR97487.1 ribosomal protein S3 (chloroplast) [Panax vietnamensis] Length = 219 Score = 91.7 bits (226), Expect = 1e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE 126 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE Sbjct: 178 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE 219 >YP_008815156.1 ribosomal protein S3 (chloroplast) [Schefflera delavayi] AGG39255.1 ribosomal protein S3 (chloroplast) [Schefflera delavayi] Length = 219 Score = 91.7 bits (226), Expect = 1e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE 126 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE Sbjct: 178 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE 219 >YP_008814895.1 ribosomal protein S3 (chloroplast) [Aralia undulata] AGG38994.1 ribosomal protein S3 (chloroplast) [Aralia undulata] Length = 219 Score = 91.7 bits (226), Expect = 1e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE 126 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE Sbjct: 178 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE 219 >YP_004935591.1 ribosomal protein S3 (chloroplast) [Eleutherococcus senticosus] YP_008814982.1 ribosomal protein S3 (chloroplast) [Brassaiopsis hainla] YP_008815069.1 ribosomal protein S3 (chloroplast) [Metapanax delavayi] YP_008815243.1 ribosomal protein S3 (chloroplast) [Kalopanax septemlobus] YP_009122764.1 ribosomal protein S3 (chloroplast) [Dendropanax dentiger] YP_009159576.1 ribosomal protein S3 (chloroplast) [Dendropanax morbifer] YP_009161718.1 ribosomal protein S3 (chloroplast) [Fatsia japonica] YP_009241090.1 ribosomal protein S3 (chloroplast) [Schefflera heptaphylla] AEO92658.1 ribosomal protein S3 (chloroplast) [Eleutherococcus senticosus] AGG39081.1 ribosomal protein S3 (chloroplast) [Brassaiopsis hainla] AGG39168.1 ribosomal protein S3 (chloroplast) [Metapanax delavayi] AGG39342.1 ribosomal protein S3 (chloroplast) [Kalopanax septemlobus] AJK29881.1 ribosomal protein S3 (chloroplast) [Dendropanax dentiger] AKQ20766.1 ribosomal protein S3 (chloroplast) [Dendropanax morbifer] AKS10992.1 ribosomal protein S3 (chloroplast) [Fatsia japonica] AMK46150.1 ribosomal protein S3 (chloroplast) [Schefflera heptaphylla] ANS71894.1 ribosomal protein S3 (chloroplast) [Eleutherococcus gracilistylus] Length = 219 Score = 91.7 bits (226), Expect = 1e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE 126 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE Sbjct: 178 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE 219 >ADK89732.1 ribosomal protein S3 (chloroplast) [Hydrocotyle verticillata] Length = 219 Score = 90.9 bits (224), Expect = 2e-17 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE 126 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIF+DGEE Sbjct: 178 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFLDGEE 219 >CCF70855.1 small ribosomal protein subunit 3, partial (chloroplast) [Stachyurus chinensis] Length = 43 Score = 85.1 bits (209), Expect = 3e-17 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE 126 WIREGRVPLQTIRAKIDYCS+TVRTIYGVLGIKIWIFID E+ Sbjct: 2 WIREGRVPLQTIRAKIDYCSHTVRTIYGVLGIKIWIFIDEEK 43 >CCF70825.1 small ribosomal protein subunit 3, partial (chloroplast) [Didymeles integrifolia] Length = 43 Score = 84.7 bits (208), Expect = 4e-17 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE 123 WIREGRVPLQTIRAKIDYCSYTV+TIYGVLGIKIWIF+D E Sbjct: 3 WIREGRVPLQTIRAKIDYCSYTVQTIYGVLGIKIWIFVDEE 43 >ADX99146.1 ribosomal protein S3, partial (chloroplast) [Citharexylum ligustrinum] Length = 195 Score = 89.4 bits (220), Expect = 4e-17 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGEE 126 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFID EE Sbjct: 153 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDNEE 194 >KMT04633.1 hypothetical protein BVRB_8g182860 [Beta vulgaris subsp. vulgaris] Length = 74 Score = 85.5 bits (210), Expect = 4e-17 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE 123 WIREGRVPLQTIRAKIDYC+YTVRTIYGVLGIKIWIFID E Sbjct: 34 WIREGRVPLQTIRAKIDYCAYTVRTIYGVLGIKIWIFIDEE 74 >CCF70861.1 small ribosomal protein subunit 3, partial (chloroplast) [Impatiens noli-tangere] Length = 43 Score = 84.3 bits (207), Expect = 5e-17 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE 123 WIREGRVPLQTIRAKIDYC YTVRTIYGVLGIKIWIFID + Sbjct: 3 WIREGRVPLQTIRAKIDYCCYTVRTIYGVLGIKIWIFIDND 43 >APU51517.1 ribosomal protein S3 (chloroplast) [Sambucus williamsii] Length = 218 Score = 89.7 bits (221), Expect = 5e-17 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE 123 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE Sbjct: 178 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE 218 >YP_009338463.1 ribosomal protein S3 (chloroplast) [Pterygopleurum neurophyllum] ANK36558.1 ribosomal protein S3 (chloroplast) [Pterygopleurum neurophyllum] Length = 218 Score = 89.7 bits (221), Expect = 5e-17 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE 123 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE Sbjct: 178 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE 218 >YP_009338379.1 ribosomal protein S3 (chloroplast) [Peucedanum insolens] ANK36474.1 ribosomal protein S3 (chloroplast) [Peucedanum insolens] Length = 218 Score = 89.7 bits (221), Expect = 5e-17 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 1 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE 123 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE Sbjct: 178 WIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDGE 218