BLASTX nr result
ID: Panax25_contig00029589
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00029589 (395 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010266308.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 1e-10 XP_019438511.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 3e-10 XP_006472504.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 3e-10 GAU23693.1 hypothetical protein TSUD_304680 [Trifolium subterran... 65 7e-10 XP_011099851.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 7e-10 XP_003602939.2 PPR containing plant-like protein [Medicago trunc... 65 1e-09 XP_018812758.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 1e-09 KZM81338.1 hypothetical protein DCAR_028951 [Daucus carota subsp... 65 1e-09 XP_017224324.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 1e-09 XP_002283907.4 PREDICTED: pentatricopeptide repeat-containing pr... 65 1e-09 XP_018812757.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 1e-09 XP_008378558.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 2e-09 XP_007223320.1 hypothetical protein PRUPE_ppa009514mg [Prunus pe... 64 2e-09 ONI35295.1 hypothetical protein PRUPE_1G528200 [Prunus persica] 64 3e-09 XP_008219391.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 3e-09 CAN80524.1 hypothetical protein VITISV_030537 [Vitis vinifera] 64 4e-09 XP_011464642.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 63 5e-09 XP_012571624.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 6e-09 XP_004501623.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 6e-09 XP_016163692.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 6e-09 >XP_010266308.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Nelumbo nucifera] XP_010266317.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Nelumbo nucifera] Length = 515 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+G +DEAIELLKEMKE EC+ADVVTFNVILGGLC + R Sbjct: 356 RAGRVDEAIELLKEMKEKECKADVVTFNVILGGLCREGR 394 >XP_019438511.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Lupinus angustifolius] OIW14551.1 hypothetical protein TanjilG_14937 [Lupinus angustifolius] Length = 511 Score = 66.6 bits (161), Expect = 3e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+G IDEAIELLKEMKENEC+ D VTFNVILGGLC + R Sbjct: 352 RNGKIDEAIELLKEMKENECQPDTVTFNVILGGLCREGR 390 >XP_006472504.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Citrus sinensis] XP_006472505.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Citrus sinensis] Length = 521 Score = 66.6 bits (161), Expect = 3e-10 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+GG+DEA+ELLKEMKE C+AD+VTFN+ILGGLC + R Sbjct: 356 RAGGVDEALELLKEMKERGCKADIVTFNIILGGLCREGR 394 >GAU23693.1 hypothetical protein TSUD_304680 [Trifolium subterraneum] Length = 512 Score = 65.5 bits (158), Expect = 7e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+G IDEAIELLKEMKEN+C AD VTFNV+LGGLC + R Sbjct: 353 RNGQIDEAIELLKEMKENKCEADTVTFNVMLGGLCREGR 391 >XP_011099851.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Sesamum indicum] Length = 515 Score = 65.5 bits (158), Expect = 7e-10 Identities = 33/47 (70%), Positives = 35/47 (74%) Frame = -3 Query: 141 TLFLWSTIRSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 T + S R G DEAIELLKEMKE ECRAD VTFNVILGGLC + R Sbjct: 348 TTLINSLCRGGRTDEAIELLKEMKEKECRADEVTFNVILGGLCREYR 394 >XP_003602939.2 PPR containing plant-like protein [Medicago truncatula] AES73190.2 PPR containing plant-like protein [Medicago truncatula] Length = 550 Score = 65.1 bits (157), Expect = 1e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+G IDEAIELL EMKEN+C+AD VTFNVILGGLC + R Sbjct: 391 RNGQIDEAIELLTEMKENDCQADTVTFNVILGGLCREGR 429 >XP_018812758.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X2 [Juglans regia] Length = 367 Score = 64.7 bits (156), Expect = 1e-09 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+G IDEA ELLKEMKE EC+AD VTFNVILGGLC + R Sbjct: 208 RAGKIDEATELLKEMKEKECKADTVTFNVILGGLCREGR 246 >KZM81338.1 hypothetical protein DCAR_028951 [Daucus carota subsp. sativus] Length = 391 Score = 64.7 bits (156), Expect = 1e-09 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = -3 Query: 141 TLFLWSTIRSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 T + RSG IDEAI++L+EMK+ ECR D V FNVILGGLCS NR Sbjct: 228 TTLITCLCRSGAIDEAIDVLQEMKQEECRTDTVIFNVILGGLCSHNR 274 >XP_017224324.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Daucus carota subsp. sativus] Length = 512 Score = 64.7 bits (156), Expect = 1e-09 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = -3 Query: 141 TLFLWSTIRSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 T + RSG IDEAI++L+EMK+ ECR D V FNVILGGLCS NR Sbjct: 349 TTLITCLCRSGAIDEAIDVLQEMKQEECRTDTVIFNVILGGLCSHNR 395 >XP_002283907.4 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Vitis vinifera] Length = 513 Score = 64.7 bits (156), Expect = 1e-09 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+G +DEA+ELLK+M+EN+CRAD VTFNVILGGLC + R Sbjct: 354 RAGRVDEAMELLKDMRENKCRADTVTFNVILGGLCREGR 392 >XP_018812757.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X1 [Juglans regia] Length = 524 Score = 64.7 bits (156), Expect = 1e-09 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+G IDEA ELLKEMKE EC+AD VTFNVILGGLC + R Sbjct: 365 RAGKIDEATELLKEMKEKECKADTVTFNVILGGLCREGR 403 >XP_008378558.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Malus domestica] XP_008378559.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Malus domestica] Length = 517 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+G ++EAIELLKEMKE EC+AD VTFNVILGGLC + R Sbjct: 357 RTGKVNEAIELLKEMKERECKADTVTFNVILGGLCREGR 395 >XP_007223320.1 hypothetical protein PRUPE_ppa009514mg [Prunus persica] Length = 289 Score = 63.5 bits (153), Expect = 2e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+G ++EAIELLKEMKE EC+AD VTFNVILGGLC + R Sbjct: 129 RTGKMNEAIELLKEMKERECKADTVTFNVILGGLCREGR 167 >ONI35295.1 hypothetical protein PRUPE_1G528200 [Prunus persica] Length = 517 Score = 63.5 bits (153), Expect = 3e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+G ++EAIELLKEMKE EC+AD VTFNVILGGLC + R Sbjct: 357 RTGKMNEAIELLKEMKERECKADTVTFNVILGGLCREGR 395 >XP_008219391.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Prunus mume] Length = 517 Score = 63.5 bits (153), Expect = 3e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+G ++EAIELLKEMKE EC+AD VTFNVILGGLC + R Sbjct: 357 RTGKMNEAIELLKEMKERECKADTVTFNVILGGLCREGR 395 >CAN80524.1 hypothetical protein VITISV_030537 [Vitis vinifera] Length = 714 Score = 63.5 bits (153), Expect = 4e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+G +DEA+ELLK+M EN+CRAD VTFNVILGGLC + R Sbjct: 397 RAGRVDEAMELLKDMXENKCRADTVTFNVILGGLCREGR 435 >XP_011464642.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g18475-like [Fragaria vesca subsp. vesca] Length = 560 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+G +DEAIELLKEMKE C+AD VTFNVILGGLC + R Sbjct: 400 RTGRVDEAIELLKEMKERRCKADTVTFNVILGGLCRECR 438 >XP_012571624.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X2 [Cicer arietinum] Length = 410 Score = 62.8 bits (151), Expect = 6e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+ IDEAIELLKEMKENEC+AD V FNVILGG+C + R Sbjct: 351 RNRKIDEAIELLKEMKENECQADTVAFNVILGGMCREGR 389 >XP_004501623.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X1 [Cicer arietinum] XP_004501624.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X1 [Cicer arietinum] XP_012571621.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X1 [Cicer arietinum] XP_012571623.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X1 [Cicer arietinum] Length = 510 Score = 62.8 bits (151), Expect = 6e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+ IDEAIELLKEMKENEC+AD V FNVILGG+C + R Sbjct: 351 RNRKIDEAIELLKEMKENECQADTVAFNVILGGMCREGR 389 >XP_016163692.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Arachis ipaensis] XP_016163693.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Arachis ipaensis] XP_016163694.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Arachis ipaensis] Length = 517 Score = 62.8 bits (151), Expect = 6e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -3 Query: 117 RSGGIDEAIELLKEMKENECRADVVTFNVILGGLCSQNR 1 R+ IDEA+ELL+EMKEN CRAD VTFNVILGGLC + R Sbjct: 358 RNKRIDEALELLEEMKENSCRADTVTFNVILGGLCREER 396