BLASTX nr result
ID: Panax25_contig00029572
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00029572 (408 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017222506.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 73 1e-12 XP_016566106.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 59 1e-07 XP_011077563.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 57 7e-07 XP_011077554.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 57 7e-07 KHN33084.1 F-box/kelch-repeat protein [Glycine soja] 55 2e-06 XP_006597565.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 55 2e-06 XP_003546119.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 55 2e-06 XP_006360353.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 54 8e-06 XP_004247844.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 54 8e-06 >XP_017222506.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Daucus carota subsp. sativus] KZM85981.1 hypothetical protein DCAR_026597 [Daucus carota subsp. sativus] Length = 388 Score = 73.2 bits (178), Expect = 1e-12 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = +3 Query: 3 NGDILLEFESHLILYNANDNTFKDPEIHKFDGCLEADTYVESLVSPN 143 NGD+L+EFES ++LYN+ N FKD EI F GCLEADTY+ESLVSP+ Sbjct: 341 NGDVLVEFESQILLYNSKSNVFKDLEITNFGGCLEADTYIESLVSPH 387 >XP_016566106.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Capsicum annuum] Length = 399 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = +3 Query: 6 GDILLEFESHLILYNANDNTFKDPEIHKFDGCLEADTYVESLVSP 140 G+ILL F S ++YN ND++ K PE++ FD CLEA+ Y+ESL+SP Sbjct: 344 GEILLVFGSIFMIYNPNDDSIKYPELNNFDACLEAEIYIESLISP 388 >XP_011077563.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like isoform X2 [Sesamum indicum] Length = 338 Score = 57.0 bits (136), Expect = 7e-07 Identities = 25/46 (54%), Positives = 31/46 (67%) Frame = +3 Query: 3 NGDILLEFESHLILYNANDNTFKDPEIHKFDGCLEADTYVESLVSP 140 NG+ILL F HL++YN DN + PE F LEAD Y+ESL+SP Sbjct: 288 NGEILLVFGMHLVVYNPKDNCLRHPETSNFGAFLEADVYIESLISP 333 >XP_011077554.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like isoform X1 [Sesamum indicum] Length = 406 Score = 57.0 bits (136), Expect = 7e-07 Identities = 25/46 (54%), Positives = 31/46 (67%) Frame = +3 Query: 3 NGDILLEFESHLILYNANDNTFKDPEIHKFDGCLEADTYVESLVSP 140 NG+ILL F HL++YN DN + PE F LEAD Y+ESL+SP Sbjct: 356 NGEILLVFGMHLVVYNPKDNCLRHPETSNFGAFLEADVYIESLISP 401 >KHN33084.1 F-box/kelch-repeat protein [Glycine soja] Length = 366 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +3 Query: 3 NGDILLEFESHLILYNANDNTFKDPEIHKFDGCLEADTYVESLVSP 140 NG++LL FE LILYN DN+FK P+I G +A+ YVE+LVSP Sbjct: 318 NGEVLLMFEFDLILYNPRDNSFKYPKIESGKGWFDAEVYVETLVSP 363 >XP_006597565.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like isoform X2 [Glycine max] KRH11340.1 hypothetical protein GLYMA_15G101600 [Glycine max] Length = 383 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +3 Query: 3 NGDILLEFESHLILYNANDNTFKDPEIHKFDGCLEADTYVESLVSP 140 NG++LL FE LILYN DN+FK P+I G +A+ YVE+LVSP Sbjct: 335 NGEVLLMFEFDLILYNPRDNSFKYPKIESGKGWFDAEVYVETLVSP 380 >XP_003546119.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like isoform X1 [Glycine max] Length = 405 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +3 Query: 3 NGDILLEFESHLILYNANDNTFKDPEIHKFDGCLEADTYVESLVSP 140 NG++LL FE LILYN DN+FK P+I G +A+ YVE+LVSP Sbjct: 357 NGEVLLMFEFDLILYNPRDNSFKYPKIESGKGWFDAEVYVETLVSP 402 >XP_006360353.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Solanum tuberosum] Length = 402 Score = 53.9 bits (128), Expect = 8e-06 Identities = 23/45 (51%), Positives = 33/45 (73%) Frame = +3 Query: 6 GDILLEFESHLILYNANDNTFKDPEIHKFDGCLEADTYVESLVSP 140 G+ILL F S ++YN +D++ + PE+ FD CLEA+ Y ESL+SP Sbjct: 347 GEILLVFGSIFMIYNPSDDSIRYPEVTNFDACLEAEIYTESLISP 391 >XP_004247844.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Solanum lycopersicum] Length = 402 Score = 53.9 bits (128), Expect = 8e-06 Identities = 23/45 (51%), Positives = 33/45 (73%) Frame = +3 Query: 6 GDILLEFESHLILYNANDNTFKDPEIHKFDGCLEADTYVESLVSP 140 G+ILL F S ++YN +D++ + PE+ FD CLEA+ Y ESL+SP Sbjct: 347 GEILLVFGSIFMIYNPSDDSIRYPEVTNFDACLEAEIYTESLISP 391