BLASTX nr result
ID: Panax25_contig00029550
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00029550 (491 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017215003.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 1e-06 >XP_017215003.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30825, chloroplastic [Daucus carota subsp. sativus] KZM92548.1 hypothetical protein DCAR_020087 [Daucus carota subsp. sativus] Length = 894 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/58 (50%), Positives = 41/58 (70%) Frame = +2 Query: 317 MAAFKFSISLDSYDIDKLNFNCYVHTTDAGIIYPFSKLKHIRVSRLDTELLDISESIL 490 MAA KF+ ++S D KL+F+ YVHT ++ PFSKLK IRVSRLD +++S+ +L Sbjct: 1 MAAIKFASLVESNDAQKLSFSGYVHTASVFVVIPFSKLKSIRVSRLDN--VELSDPVL 56