BLASTX nr result
ID: Panax25_contig00029362
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00029362 (615 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN10829.1 hypothetical protein DCAR_003485 [Daucus carota subsp... 56 7e-07 >KZN10829.1 hypothetical protein DCAR_003485 [Daucus carota subsp. sativus] Length = 110 Score = 55.8 bits (133), Expect = 7e-07 Identities = 37/84 (44%), Positives = 45/84 (53%), Gaps = 2/84 (2%) Frame = -1 Query: 534 HRSSGYSKTIIRNQEHNPVRGFFPIYV--ECEEYDVPLEFLYSKRFLEFLEQYEDEIHAK 361 HR YS T N + G FPIYV E + Y +P++ L S R L+Q++DEI A Sbjct: 20 HRGCRYSGTENSNGRVSVPSGCFPIYVGEEHKRYAIPVKRLSSTRLQALLDQFKDEI-AD 78 Query: 360 PNEPITLPCSKQDFEAEFNLVKAE 289 EPITLPCS FE L K E Sbjct: 79 SEEPITLPCSPVMFEHVLGLPKHE 102