BLASTX nr result
ID: Panax25_contig00029101
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00029101 (498 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018816417.1 PREDICTED: probable Xaa-Pro aminopeptidase 3 [Jug... 55 1e-06 XP_010270847.1 PREDICTED: probable Xaa-Pro aminopeptidase 3 [Nel... 56 3e-06 >XP_018816417.1 PREDICTED: probable Xaa-Pro aminopeptidase 3 [Juglans regia] Length = 167 Score = 55.5 bits (132), Expect = 1e-06 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -2 Query: 128 MCIFQVELYDLILETNKECVKLCKPGTSLRDI 33 MC+FQ ELYDLI++T+KEC+KLCKPG ++R I Sbjct: 1 MCLFQDELYDLIMQTSKECMKLCKPGATIRQI 32 >XP_010270847.1 PREDICTED: probable Xaa-Pro aminopeptidase 3 [Nelumbo nucifera] Length = 488 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -2 Query: 116 QVELYDLILETNKECVKLCKPGTSLRDI 33 Q ELYDLILETNKECVKLCKPGTS+R+I Sbjct: 325 QEELYDLILETNKECVKLCKPGTSIREI 352