BLASTX nr result
ID: Panax25_contig00028890
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00028890 (631 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU20946.1 hypothetical protein MIMGU_mgv1a022114mg, partial [Er... 55 6e-07 >EYU20946.1 hypothetical protein MIMGU_mgv1a022114mg, partial [Erythranthe guttata] Length = 70 Score = 55.1 bits (131), Expect = 6e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -2 Query: 96 SYNSSLFFHVFPGGLEKVTINKISLILPYRKE 1 SY+S LFFH FPGGLEK IN+ISLILP RKE Sbjct: 11 SYHSGLFFHAFPGGLEKAAINRISLILPSRKE 42