BLASTX nr result
ID: Panax25_contig00028540
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00028540 (629 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016448338.1 PREDICTED: probable inactive heme oxygenase 2, ch... 56 5e-06 XP_016455498.1 PREDICTED: probable inactive heme oxygenase 2, ch... 56 5e-06 XP_018622940.1 PREDICTED: probable inactive heme oxygenase 2, ch... 56 7e-06 XP_009780291.1 PREDICTED: probable inactive heme oxygenase 2, ch... 56 7e-06 XP_019245072.1 PREDICTED: probable inactive heme oxygenase 2, ch... 56 7e-06 >XP_016448338.1 PREDICTED: probable inactive heme oxygenase 2, chloroplastic, partial [Nicotiana tabacum] Length = 260 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 308 MAPAPPVRLTRIRYRKQYPGEKNGITEEMRFVAM 207 +A PPV+ R RYRKQYPGEK GITEEMRFVAM Sbjct: 14 LAKKPPVKRKRRRYRKQYPGEKKGITEEMRFVAM 47 >XP_016455498.1 PREDICTED: probable inactive heme oxygenase 2, chloroplastic [Nicotiana tabacum] Length = 282 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 308 MAPAPPVRLTRIRYRKQYPGEKNGITEEMRFVAM 207 +A PPV+ R RYRKQYPGEK GITEEMRFVAM Sbjct: 95 LAKKPPVKRKRRRYRKQYPGEKKGITEEMRFVAM 128 >XP_018622940.1 PREDICTED: probable inactive heme oxygenase 2, chloroplastic [Nicotiana tomentosiformis] XP_018622941.1 PREDICTED: probable inactive heme oxygenase 2, chloroplastic [Nicotiana tomentosiformis] Length = 342 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 308 MAPAPPVRLTRIRYRKQYPGEKNGITEEMRFVAM 207 +A PPV+ R RYRKQYPGEK GITEEMRFVAM Sbjct: 95 LAKKPPVKRKRRRYRKQYPGEKKGITEEMRFVAM 128 >XP_009780291.1 PREDICTED: probable inactive heme oxygenase 2, chloroplastic [Nicotiana sylvestris] Length = 344 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 308 MAPAPPVRLTRIRYRKQYPGEKNGITEEMRFVAM 207 +A PPV+ R RYRKQYPGEK GITEEMRFVAM Sbjct: 98 LAKKPPVKRKRRRYRKQYPGEKKGITEEMRFVAM 131 >XP_019245072.1 PREDICTED: probable inactive heme oxygenase 2, chloroplastic [Nicotiana attenuata] OIT04130.1 putative inactive heme oxygenase 2, chloroplastic [Nicotiana attenuata] Length = 355 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 308 MAPAPPVRLTRIRYRKQYPGEKNGITEEMRFVAM 207 +A PPV+ R RYRKQYPGEK GITEEMRFVAM Sbjct: 109 LAKKPPVKRKRRRYRKQYPGEKKGITEEMRFVAM 142