BLASTX nr result
ID: Panax25_contig00028457
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00028457 (469 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN10951.1 hypothetical protein DCAR_003607 [Daucus carota subsp... 57 1e-06 >KZN10951.1 hypothetical protein DCAR_003607 [Daucus carota subsp. sativus] Length = 653 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 LLQATNEKVKALLELAQLKQEYYLLQEYDIF 94 LLQ TNEKV AL+ELAQLKQ+YYLLQEYDIF Sbjct: 419 LLQVTNEKVNALMELAQLKQDYYLLQEYDIF 449