BLASTX nr result
ID: Panax25_contig00028452
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00028452 (390 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN07199.1 hypothetical protein DCAR_008036 [Daucus carota subsp... 68 2e-12 >KZN07199.1 hypothetical protein DCAR_008036 [Daucus carota subsp. sativus] Length = 85 Score = 67.8 bits (164), Expect = 2e-12 Identities = 40/85 (47%), Positives = 51/85 (60%), Gaps = 4/85 (4%) Frame = +2 Query: 86 MASLVLLVSELLKHPNTDLAYSTS--LPLXXXXXXXXXXXXXFTEKRVAKQPATTPADGR 259 MASL+LL SELLKH +TDL S+S LP FTE R AK P + Sbjct: 1 MASLLLLASELLKHSHTDLTCSSSPALPFYSCGATNSAGVPCFTENRAAKLPERALTSRQ 60 Query: 260 -CNKGDNFGEDLSDLRVC-VDLVWP 328 CN+ ++F ED++DLR+C VD+VWP Sbjct: 61 FCNEKEDFEEDIADLRICVVDIVWP 85