BLASTX nr result
ID: Panax25_contig00028450
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00028450 (428 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ANN87795.1 WRKY7 [Panax ginseng] 81 2e-15 AEQ29022.1 WRKY9 [Panax quinquefolius] 69 4e-11 ALS20400.1 WRKY6 [Panax ginseng] 64 2e-09 AEQ29019.1 WRKY6 [Panax quinquefolius] 64 2e-09 >ANN87795.1 WRKY7 [Panax ginseng] Length = 337 Score = 80.9 bits (198), Expect = 2e-15 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 428 SVTNSPIGDWDLNLNFSLDQVDFDPKFPLDILEFFH 321 SVTNSPIGDWDLNLNFSLDQVDFDPKFPLDILEFFH Sbjct: 302 SVTNSPIGDWDLNLNFSLDQVDFDPKFPLDILEFFH 337 >AEQ29022.1 WRKY9 [Panax quinquefolius] Length = 346 Score = 69.3 bits (168), Expect = 4e-11 Identities = 34/41 (82%), Positives = 37/41 (90%), Gaps = 1/41 (2%) Frame = -1 Query: 428 SVTNSPIGDWDLNLNFSLDQVDFDPKFPLDILE-FFH*LNS 309 SVTNSPIGDWDL+L+FSLDQVDFDP FPLDIL+ FF LNS Sbjct: 306 SVTNSPIGDWDLDLDFSLDQVDFDPNFPLDILDHFFTSLNS 346 >ALS20400.1 WRKY6 [Panax ginseng] Length = 346 Score = 64.3 bits (155), Expect = 2e-09 Identities = 33/41 (80%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 428 SVTNSPIGDWDLNLNFSLDQVDFDPKFPLDILE-FFH*LNS 309 SVTNSPIGD DL+L+FSLDQVDFDP FPLDIL+ FF LNS Sbjct: 306 SVTNSPIGDLDLDLDFSLDQVDFDPNFPLDILDHFFTSLNS 346 >AEQ29019.1 WRKY6 [Panax quinquefolius] Length = 346 Score = 64.3 bits (155), Expect = 2e-09 Identities = 33/41 (80%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 428 SVTNSPIGDWDLNLNFSLDQVDFDPKFPLDILE-FFH*LNS 309 SVTNSPIGD DL+L+FSLDQVDFDP FPLDIL+ FF LNS Sbjct: 306 SVTNSPIGDLDLDLDFSLDQVDFDPNFPLDILDHFFTSLNS 346