BLASTX nr result
ID: Panax25_contig00028161
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00028161 (886 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV43497.1 hypothetical protein F511_19041 [Dorcoceras hygrometr... 57 9e-07 XP_006293763.1 hypothetical protein CARUB_v10022723mg [Capsella ... 59 3e-06 KZM80659.1 hypothetical protein DCAR_031886 [Daucus carota subsp... 58 5e-06 KVH93915.1 Nucleoporin, NSP1-like, C-terminal [Cynara cardunculu... 58 9e-06 NP_001332778.1 nucleoporin-like protein [Solanum lycopersicum] 58 1e-05 XP_015060576.1 PREDICTED: nuclear pore complex protein NUP62 [So... 58 1e-05 XP_017228456.1 PREDICTED: nuclear pore complex protein NUP62 iso... 58 1e-05 XP_017228455.1 PREDICTED: nuclear pore complex protein NUP62 iso... 58 1e-05 >KZV43497.1 hypothetical protein F511_19041 [Dorcoceras hygrometricum] Length = 120 Score = 57.0 bits (136), Expect = 9e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +2 Query: 746 TDGMTPLDVVVRILNNQLSSLMWIDEK 826 TDGMTPLD+VVRILNNQLSSLMW+DEK Sbjct: 64 TDGMTPLDIVVRILNNQLSSLMWVDEK 90 >XP_006293763.1 hypothetical protein CARUB_v10022723mg [Capsella rubella] EOA26661.1 hypothetical protein CARUB_v10022723mg [Capsella rubella] Length = 723 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 749 DGMTPLDVVVRILNNQLSSLMWIDEKVRFV 838 DGM+PLDVVVRILNNQLSSLMWIDEKV FV Sbjct: 682 DGMSPLDVVVRILNNQLSSLMWIDEKVSFV 711 >KZM80659.1 hypothetical protein DCAR_031886 [Daucus carota subsp. sativus] Length = 282 Score = 57.8 bits (138), Expect = 5e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 746 TDGMTPLDVVVRILNNQLSSLMWIDEK 826 TDGMTPLDVVVRILNNQLSSLMWIDEK Sbjct: 226 TDGMTPLDVVVRILNNQLSSLMWIDEK 252 >KVH93915.1 Nucleoporin, NSP1-like, C-terminal [Cynara cardunculus var. scolymus] Length = 631 Score = 57.8 bits (138), Expect = 9e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 746 TDGMTPLDVVVRILNNQLSSLMWIDEK 826 TDGMTPLDVVVRILNNQLSSLMWIDEK Sbjct: 574 TDGMTPLDVVVRILNNQLSSLMWIDEK 600 >NP_001332778.1 nucleoporin-like protein [Solanum lycopersicum] Length = 758 Score = 57.8 bits (138), Expect = 1e-05 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 746 TDGMTPLDVVVRILNNQLSSLMWIDEK 826 TDGMTPLDVVVRILNNQLSSLMWIDEK Sbjct: 701 TDGMTPLDVVVRILNNQLSSLMWIDEK 727 >XP_015060576.1 PREDICTED: nuclear pore complex protein NUP62 [Solanum pennellii] Length = 764 Score = 57.8 bits (138), Expect = 1e-05 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 746 TDGMTPLDVVVRILNNQLSSLMWIDEK 826 TDGMTPLDVVVRILNNQLSSLMWIDEK Sbjct: 707 TDGMTPLDVVVRILNNQLSSLMWIDEK 733 >XP_017228456.1 PREDICTED: nuclear pore complex protein NUP62 isoform X3 [Daucus carota subsp. sativus] Length = 785 Score = 57.8 bits (138), Expect = 1e-05 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 746 TDGMTPLDVVVRILNNQLSSLMWIDEK 826 TDGMTPLDVVVRILNNQLSSLMWIDEK Sbjct: 729 TDGMTPLDVVVRILNNQLSSLMWIDEK 755 >XP_017228455.1 PREDICTED: nuclear pore complex protein NUP62 isoform X2 [Daucus carota subsp. sativus] Length = 786 Score = 57.8 bits (138), Expect = 1e-05 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 746 TDGMTPLDVVVRILNNQLSSLMWIDEK 826 TDGMTPLDVVVRILNNQLSSLMWIDEK Sbjct: 730 TDGMTPLDVVVRILNNQLSSLMWIDEK 756