BLASTX nr result
ID: Panax25_contig00027337
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00027337 (366 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EOY08917.1 DegP protease 10 isoform 2 [Theobroma cacao] 54 6e-06 KZM80140.1 hypothetical protein DCAR_000193 [Daucus carota subsp... 51 7e-06 KZN11438.1 hypothetical protein DCAR_004094 [Daucus carota subsp... 52 8e-06 >EOY08917.1 DegP protease 10 isoform 2 [Theobroma cacao] Length = 537 Score = 53.9 bits (128), Expect = 6e-06 Identities = 26/44 (59%), Positives = 31/44 (70%) Frame = -3 Query: 364 PRRLCERTLRELPKKAGEQLVILSQAFLFSTNLCFFSILYLHCQ 233 PRRLCER LRELPK+AGEQLVILSQ + N + + L C+ Sbjct: 485 PRRLCERALRELPKQAGEQLVILSQVLMDDINAGYERLAELQCR 528 >KZM80140.1 hypothetical protein DCAR_000193 [Daucus carota subsp. sativus] Length = 96 Score = 50.8 bits (120), Expect = 7e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -3 Query: 364 PRRLCERTLRELPKKAGEQLVILSQ 290 PRRLCER LRELPKKAGEQLVILSQ Sbjct: 71 PRRLCERALRELPKKAGEQLVILSQ 95 >KZN11438.1 hypothetical protein DCAR_004094 [Daucus carota subsp. sativus] Length = 185 Score = 52.4 bits (124), Expect = 8e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -3 Query: 364 PRRLCERTLRELPKKAGEQLVILSQAFLFSTN 269 PRRLCER LRELPKKAGEQLVILSQ + N Sbjct: 71 PRRLCERALRELPKKAGEQLVILSQVLMDDIN 102