BLASTX nr result
ID: Panax25_contig00027289
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00027289 (913 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY22879.1 hypothetical protein MANES_18G033500 [Manihot esculenta] 60 1e-06 XP_017249696.1 PREDICTED: probable inactive heme oxygenase 2, ch... 59 2e-06 XP_011074459.1 PREDICTED: LOW QUALITY PROTEIN: probable inactive... 58 7e-06 >OAY22879.1 hypothetical protein MANES_18G033500 [Manihot esculenta] Length = 327 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = -3 Query: 911 EKSPPLFFCHFYNIYFSHIACGQVIGKQVCCTGICFLDY 795 EKS PLF CHFYNIYFSHIA GQVI +QV C+LDY Sbjct: 220 EKSAPLFLCHFYNIYFSHIASGQVIARQV-----CWLDY 253 >XP_017249696.1 PREDICTED: probable inactive heme oxygenase 2, chloroplastic [Daucus carota subsp. sativus] KZM96222.1 hypothetical protein DCAR_019464 [Daucus carota subsp. sativus] Length = 302 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 911 EKSPPLFFCHFYNIYFSHIACGQVIGKQV 825 E SPPLF CHFYNIYFSHIA GQVIGKQV Sbjct: 209 ETSPPLFLCHFYNIYFSHIAGGQVIGKQV 237 >XP_011074459.1 PREDICTED: LOW QUALITY PROTEIN: probable inactive heme oxygenase 2, chloroplastic [Sesamum indicum] Length = 351 Score = 57.8 bits (138), Expect = 7e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 911 EKSPPLFFCHFYNIYFSHIACGQVIGKQV 825 EK+PPLF CHFYNIYFSHIA GQVI KQV Sbjct: 258 EKTPPLFLCHFYNIYFSHIAGGQVIAKQV 286