BLASTX nr result
ID: Panax25_contig00027232
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00027232 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO49699.1 hypothetical protein CCACVL1_30848 [Corchorus capsula... 70 1e-13 KDO85947.1 hypothetical protein CISIN_1g034276mg [Citrus sinensis] 70 1e-13 KZV35124.1 hypothetical protein F511_20217 [Dorcoceras hygrometr... 70 3e-13 OMO78694.1 hypothetical protein CCACVL1_14196 [Corchorus capsula... 70 3e-13 XP_018847589.1 PREDICTED: ubiquitin-related modifier 1 homolog 2... 70 3e-13 OAY62373.1 hypothetical protein MANES_01G263100 [Manihot esculenta] 70 3e-13 XP_016748250.1 PREDICTED: ubiquitin-related modifier 1 homolog 2... 70 3e-13 XP_017631060.1 PREDICTED: ubiquitin-related modifier 1 homolog 2... 70 3e-13 XP_008460154.1 PREDICTED: ubiquitin-related modifier 1 homolog 2... 70 3e-13 XP_002511777.1 PREDICTED: ubiquitin-related modifier 1 homolog 2... 70 3e-13 XP_006445187.1 hypothetical protein CICLE_v10023026mg [Citrus cl... 70 3e-13 XP_004144991.1 PREDICTED: ubiquitin-related modifier 1 homolog 2... 70 3e-13 KGN46212.1 hypothetical protein Csa_6G075130 [Cucumis sativus] 70 3e-13 XP_002278537.1 PREDICTED: ubiquitin-related modifier 1 homolog 2... 70 4e-13 CAN82245.1 hypothetical protein VITISV_018251 [Vitis vinifera] 70 4e-13 XP_012489854.1 PREDICTED: ubiquitin-related modifier 1 homolog 2... 69 8e-13 XP_010413492.1 PREDICTED: ubiquitin-related modifier 1 homolog 2... 69 8e-13 KFK37359.1 hypothetical protein AALP_AA4G246400 [Arabis alpina] 69 8e-13 EOX96118.1 Ubiquitin related modifier 1 [Theobroma cacao] 69 8e-13 XP_010508125.1 PREDICTED: ubiquitin-related modifier 1 homolog 1... 69 8e-13 >OMO49699.1 hypothetical protein CCACVL1_30848 [Corchorus capsularis] Length = 62 Score = 70.1 bits (170), Expect = 1e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVF+ H Sbjct: 21 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLH 56 >KDO85947.1 hypothetical protein CISIN_1g034276mg [Citrus sinensis] Length = 73 Score = 70.1 bits (170), Expect = 1e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVF+ H Sbjct: 36 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLH 71 >KZV35124.1 hypothetical protein F511_20217 [Dorcoceras hygrometricum] Length = 98 Score = 70.1 bits (170), Expect = 3e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVF+ H Sbjct: 61 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLH 96 >OMO78694.1 hypothetical protein CCACVL1_14196 [Corchorus capsularis] OMP00473.1 hypothetical protein COLO4_12638 [Corchorus olitorius] Length = 99 Score = 70.1 bits (170), Expect = 3e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVF+ H Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLH 97 >XP_018847589.1 PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Juglans regia] Length = 99 Score = 70.1 bits (170), Expect = 3e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVF+ H Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLH 97 >OAY62373.1 hypothetical protein MANES_01G263100 [Manihot esculenta] Length = 99 Score = 70.1 bits (170), Expect = 3e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVF+ H Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLH 97 >XP_016748250.1 PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Gossypium hirsutum] Length = 99 Score = 70.1 bits (170), Expect = 3e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVF+ H Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLH 97 >XP_017631060.1 PREDICTED: ubiquitin-related modifier 1 homolog 2 [Gossypium arboreum] KHG17369.1 Ubiquitin-related modifier 1 -like protein [Gossypium arboreum] Length = 99 Score = 70.1 bits (170), Expect = 3e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVF+ H Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLH 97 >XP_008460154.1 PREDICTED: ubiquitin-related modifier 1 homolog 2 [Cucumis melo] Length = 99 Score = 70.1 bits (170), Expect = 3e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVF+ H Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLH 97 >XP_002511777.1 PREDICTED: ubiquitin-related modifier 1 homolog 2 [Ricinus communis] EEF50446.1 Protein C9orf74, putative [Ricinus communis] Length = 99 Score = 70.1 bits (170), Expect = 3e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVF+ H Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLH 97 >XP_006445187.1 hypothetical protein CICLE_v10023026mg [Citrus clementina] XP_006490978.1 PREDICTED: ubiquitin-related modifier 1 homolog 2 [Citrus sinensis] ESR58427.1 hypothetical protein CICLE_v10023026mg [Citrus clementina] KDO85946.1 hypothetical protein CISIN_1g034276mg [Citrus sinensis] Length = 99 Score = 70.1 bits (170), Expect = 3e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVF+ H Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLH 97 >XP_004144991.1 PREDICTED: ubiquitin-related modifier 1 homolog 2 [Cucumis sativus] Length = 99 Score = 70.1 bits (170), Expect = 3e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVF+ H Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLH 97 >KGN46212.1 hypothetical protein Csa_6G075130 [Cucumis sativus] Length = 103 Score = 70.1 bits (170), Expect = 3e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVF+ H Sbjct: 66 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLH 101 >XP_002278537.1 PREDICTED: ubiquitin-related modifier 1 homolog 2 [Vitis vinifera] CBI38838.3 unnamed protein product, partial [Vitis vinifera] Length = 99 Score = 69.7 bits (169), Expect = 4e-13 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKDV+VF+ H Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVIVFISTLH 97 >CAN82245.1 hypothetical protein VITISV_018251 [Vitis vinifera] Length = 105 Score = 69.7 bits (169), Expect = 4e-13 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKDV+VF+ H Sbjct: 68 RPGVLVLVNDCDWELSGQLDTTLEEKDVIVFISTLH 103 >XP_012489854.1 PREDICTED: ubiquitin-related modifier 1 homolog 2 [Gossypium raimondii] XP_016695441.1 PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Gossypium hirsutum] KJB41207.1 hypothetical protein B456_007G094600 [Gossypium raimondii] Length = 99 Score = 68.9 bits (167), Expect = 8e-13 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLEEKD+VVF+ H Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDLVVFISTLH 97 >XP_010413492.1 PREDICTED: ubiquitin-related modifier 1 homolog 2 [Camelina sativa] Length = 99 Score = 68.9 bits (167), Expect = 8e-13 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTTLE+KDVVVF+ H Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEDKDVVVFISTLH 97 >KFK37359.1 hypothetical protein AALP_AA4G246400 [Arabis alpina] Length = 99 Score = 68.9 bits (167), Expect = 8e-13 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTT+EEKDV+VF+ H Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTIEEKDVIVFISTLH 97 >EOX96118.1 Ubiquitin related modifier 1 [Theobroma cacao] Length = 99 Score = 68.9 bits (167), Expect = 8e-13 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWEL+GQLDTTLEEKDVVVF+ H Sbjct: 62 RPGVLVLVNDCDWELTGQLDTTLEEKDVVVFISTLH 97 >XP_010508125.1 PREDICTED: ubiquitin-related modifier 1 homolog 1 [Camelina sativa] Length = 102 Score = 68.9 bits (167), Expect = 8e-13 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 373 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFLINYH 266 RPGVLVLVNDCDWELSGQLDTT+EEKDV+VF+ H Sbjct: 65 RPGVLVLVNDCDWELSGQLDTTIEEKDVIVFISTLH 100