BLASTX nr result
ID: Panax25_contig00027099
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00027099 (655 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015879115.1 PREDICTED: ribosomal RNA-processing protein 8-lik... 50 5e-08 XP_015879023.1 PREDICTED: ribosomal RNA-processing protein 8-lik... 50 2e-07 XP_004515447.2 PREDICTED: ribosomal RNA-processing protein 8-lik... 47 1e-06 XP_018838251.1 PREDICTED: ribosomal RNA-processing protein 8 [Ju... 46 2e-06 XP_016162974.1 PREDICTED: ribosomal RNA-processing protein 8 [Ar... 45 4e-06 XP_004493600.1 PREDICTED: ribosomal RNA-processing protein 8-lik... 45 5e-06 XP_007151418.1 hypothetical protein PHAVU_004G044500g [Phaseolus... 44 7e-06 AGV54764.1 ribosomal RNA-processing protein 8-like protein [Phas... 44 7e-06 >XP_015879115.1 PREDICTED: ribosomal RNA-processing protein 8-like [Ziziphus jujuba] Length = 294 Score = 49.7 bits (117), Expect(2) = 5e-08 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = +1 Query: 223 IPLFYTLQEKQNSKKEIEWPELKPCLYKRR 312 I L++ +E+QN KK+IEWPELKPC+YKRR Sbjct: 265 ILLYFKKKEEQNVKKQIEWPELKPCIYKRR 294 Score = 35.4 bits (80), Expect(2) = 5e-08 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +3 Query: 87 TSVQDFSNKMFILFYFKKK 143 T+ +DFSNKMFIL YFKKK Sbjct: 254 TAFKDFSNKMFILLYFKKK 272 >XP_015879023.1 PREDICTED: ribosomal RNA-processing protein 8-like [Ziziphus jujuba] Length = 294 Score = 49.7 bits (117), Expect(2) = 2e-07 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = +1 Query: 223 IPLFYTLQEKQNSKKEIEWPELKPCLYKRR 312 I L++ +E+QN KK+IEWPELKPC+YKRR Sbjct: 265 ILLYFKKKEEQNIKKQIEWPELKPCIYKRR 294 Score = 33.1 bits (74), Expect(2) = 2e-07 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +3 Query: 87 TSVQDFSNKMFILFYFKKK 143 T+ +D SNKMFIL YFKKK Sbjct: 254 TAFKDLSNKMFILLYFKKK 272 >XP_004515447.2 PREDICTED: ribosomal RNA-processing protein 8-like [Cicer arietinum] Length = 272 Score = 47.0 bits (110), Expect(2) = 1e-06 Identities = 21/31 (67%), Positives = 26/31 (83%), Gaps = 1/31 (3%) Frame = +1 Query: 223 IPLFYTLQEKQNSKK-EIEWPELKPCLYKRR 312 I ++T +EK+N+KK EIEWP LKPCLYKRR Sbjct: 242 ILFYFTKKEKKNAKKKEIEWPSLKPCLYKRR 272 Score = 33.5 bits (75), Expect(2) = 1e-06 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +3 Query: 96 QDFSNKMFILFYFKKK 143 +DFSNKMFILFYF KK Sbjct: 234 RDFSNKMFILFYFTKK 249 >XP_018838251.1 PREDICTED: ribosomal RNA-processing protein 8 [Juglans regia] Length = 289 Score = 46.2 bits (108), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 27/31 (87%), Gaps = 1/31 (3%) Frame = +1 Query: 223 IPLFYTLQEKQN-SKKEIEWPELKPCLYKRR 312 I L++ ++KQN ++KEI+WPELKPCLYKRR Sbjct: 259 IILYFKKKDKQNPNRKEIQWPELKPCLYKRR 289 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 13/19 (68%), Positives = 17/19 (89%) Frame = +3 Query: 87 TSVQDFSNKMFILFYFKKK 143 + ++DFSNKMFI+ YFKKK Sbjct: 248 SELKDFSNKMFIILYFKKK 266 >XP_016162974.1 PREDICTED: ribosomal RNA-processing protein 8 [Arachis ipaensis] XP_016162975.1 PREDICTED: ribosomal RNA-processing protein 8 [Arachis ipaensis] XP_016162976.1 PREDICTED: ribosomal RNA-processing protein 8 [Arachis ipaensis] Length = 261 Score = 45.1 bits (105), Expect(2) = 4e-06 Identities = 21/31 (67%), Positives = 25/31 (80%), Gaps = 1/31 (3%) Frame = +1 Query: 223 IPLFYTLQEKQNSK-KEIEWPELKPCLYKRR 312 I ++T ++KQN K KEIEWP LKPCLYKRR Sbjct: 231 ILFYFTKKDKQNFKRKEIEWPLLKPCLYKRR 261 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +3 Query: 96 QDFSNKMFILFYFKKK 143 +DFSNKMFILFYF KK Sbjct: 223 KDFSNKMFILFYFTKK 238 >XP_004493600.1 PREDICTED: ribosomal RNA-processing protein 8-like [Cicer arietinum] Length = 272 Score = 44.7 bits (104), Expect(2) = 5e-06 Identities = 20/31 (64%), Positives = 25/31 (80%), Gaps = 1/31 (3%) Frame = +1 Query: 223 IPLFYTLQEKQNSK-KEIEWPELKPCLYKRR 312 I ++T +E +N+K KEIEWP LKPCLYKRR Sbjct: 242 ILFYFTKKEMKNAKRKEIEWPSLKPCLYKRR 272 Score = 33.5 bits (75), Expect(2) = 5e-06 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +3 Query: 96 QDFSNKMFILFYFKKK 143 +DFSNKMFILFYF KK Sbjct: 234 RDFSNKMFILFYFTKK 249 >XP_007151418.1 hypothetical protein PHAVU_004G044500g [Phaseolus vulgaris] ESW23412.1 hypothetical protein PHAVU_004G044500g [Phaseolus vulgaris] Length = 261 Score = 44.3 bits (103), Expect(2) = 7e-06 Identities = 20/31 (64%), Positives = 25/31 (80%), Gaps = 1/31 (3%) Frame = +1 Query: 223 IPLFYTLQEKQ-NSKKEIEWPELKPCLYKRR 312 I ++T +EKQ ++KEIEWP LKPCLYKRR Sbjct: 231 ILFYFTKKEKQIPNRKEIEWPSLKPCLYKRR 261 Score = 33.5 bits (75), Expect(2) = 7e-06 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +3 Query: 96 QDFSNKMFILFYFKKK 143 +DFSNKMFILFYF KK Sbjct: 223 KDFSNKMFILFYFTKK 238 >AGV54764.1 ribosomal RNA-processing protein 8-like protein [Phaseolus vulgaris] Length = 261 Score = 44.3 bits (103), Expect(2) = 7e-06 Identities = 20/31 (64%), Positives = 25/31 (80%), Gaps = 1/31 (3%) Frame = +1 Query: 223 IPLFYTLQEKQ-NSKKEIEWPELKPCLYKRR 312 I ++T +EKQ ++KEIEWP LKPCLYKRR Sbjct: 231 ILFYFTKKEKQIPNRKEIEWPSLKPCLYKRR 261 Score = 33.5 bits (75), Expect(2) = 7e-06 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +3 Query: 96 QDFSNKMFILFYFKKK 143 +DFSNKMFILFYF KK Sbjct: 223 KDFSNKMFILFYFTKK 238