BLASTX nr result
ID: Panax25_contig00026519
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00026519 (377 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFX00739.1 cellulose synthase, partial [Pinus pinaster] 69 1e-12 XP_016198014.1 PREDICTED: cellulose synthase A catalytic subunit... 72 3e-12 CBI37171.3 unnamed protein product, partial [Vitis vinifera] 72 3e-12 XP_015959810.1 PREDICTED: LOW QUALITY PROTEIN: cellulose synthas... 72 3e-12 XP_007158869.1 hypothetical protein PHAVU_002G188600g [Phaseolus... 72 3e-12 XP_018827268.1 PREDICTED: cellulose synthase A catalytic subunit... 72 3e-12 XP_002273521.1 PREDICTED: cellulose synthase A catalytic subunit... 72 3e-12 XP_014623750.1 PREDICTED: cellulose synthase A catalytic subunit... 72 3e-12 KHN47729.1 Cellulose synthase A catalytic subunit 4 [UDP-forming... 72 3e-12 XP_018847186.1 PREDICTED: cellulose synthase A catalytic subunit... 72 3e-12 KYP43717.1 Cellulose synthase A catalytic subunit 4 [UDP-forming... 72 3e-12 KYP43719.1 Cellulose synthase A catalytic subunit 4 [UDP-forming... 72 3e-12 AHY28736.1 cellulose synthase, partial [Pinus echinata] 67 3e-12 XP_007138849.1 hypothetical protein PHAVU_009G242700g [Phaseolus... 72 4e-12 GAU43181.1 hypothetical protein TSUD_301470 [Trifolium subterran... 71 6e-12 KCW89002.1 hypothetical protein EUGRSUZ_A01324 [Eucalyptus grandis] 71 6e-12 AGJ71353.1 cellulose synthase 2, partial [Eucalyptus urophylla] 71 6e-12 XP_008339053.1 PREDICTED: cellulose synthase A catalytic subunit... 71 6e-12 XP_015957971.1 PREDICTED: LOW QUALITY PROTEIN: cellulose synthas... 71 6e-12 XP_003532664.1 PREDICTED: cellulose synthase A catalytic subunit... 71 6e-12 >AFX00739.1 cellulose synthase, partial [Pinus pinaster] Length = 122 Score = 69.3 bits (168), Expect = 1e-12 Identities = 32/53 (60%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 +G IYGSVTEDILTGFK+HCRGW+S+YCMPK GS + L LRW Sbjct: 43 VGWIYGSVTEDILTGFKMHCRGWRSIYCMPKRPAFKGSAPINLSDRLHQVLRW 95 >XP_016198014.1 PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like [Arachis ipaensis] Length = 904 Score = 72.0 bits (175), Expect = 3e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 595 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRAAFKGSAPINLSDRLHQVLRW 647 >CBI37171.3 unnamed protein product, partial [Vitis vinifera] Length = 1000 Score = 72.0 bits (175), Expect = 3e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 691 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRAAFKGSAPINLSDRLHQVLRW 743 >XP_015959810.1 PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic subunit 4 [UDP-forming]-like, partial [Arachis duranensis] Length = 1007 Score = 72.0 bits (175), Expect = 3e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 698 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRAAFKGSAPINLSDRLHQVLRW 750 >XP_007158869.1 hypothetical protein PHAVU_002G188600g [Phaseolus vulgaris] ESW30863.1 hypothetical protein PHAVU_002G188600g [Phaseolus vulgaris] Length = 1034 Score = 72.0 bits (175), Expect = 3e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 725 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRAAFKGSAPINLSDRLHQVLRW 777 >XP_018827268.1 PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like [Juglans regia] Length = 1044 Score = 72.0 bits (175), Expect = 3e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 735 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRAAFKGSAPINLSDRLHQVLRW 787 >XP_002273521.1 PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] [Vitis vinifera] Length = 1044 Score = 72.0 bits (175), Expect = 3e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 735 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRAAFKGSAPINLSDRLHQVLRW 787 >XP_014623750.1 PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like [Glycine max] Length = 1050 Score = 72.0 bits (175), Expect = 3e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 741 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRAAFKGSAPINLSDRLHQVLRW 793 >KHN47729.1 Cellulose synthase A catalytic subunit 4 [UDP-forming] [Glycine soja] Length = 1050 Score = 72.0 bits (175), Expect = 3e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 741 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRAAFKGSAPINLSDRLHQVLRW 793 >XP_018847186.1 PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like [Juglans regia] Length = 1055 Score = 72.0 bits (175), Expect = 3e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 746 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRAAFKGSAPINLSDRLHQVLRW 798 >KYP43717.1 Cellulose synthase A catalytic subunit 4 [UDP-forming], partial [Cajanus cajan] Length = 1058 Score = 72.0 bits (175), Expect = 3e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 749 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRAAFKGSAPINLSDRLHQVLRW 801 >KYP43719.1 Cellulose synthase A catalytic subunit 4 [UDP-forming] [Cajanus cajan] Length = 1068 Score = 72.0 bits (175), Expect = 3e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 759 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRAAFKGSAPINLSDRLHQVLRW 811 >AHY28736.1 cellulose synthase, partial [Pinus echinata] Length = 75 Score = 66.6 bits (161), Expect = 3e-12 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 +G IYGSVTEDILTGFK+H RGW+S+YCMPK GS + L+ LRW Sbjct: 1 LGWIYGSVTEDILTGFKMHTRGWRSIYCMPKRAAFKGSAPINLSDRLNQVLRW 53 >XP_007138849.1 hypothetical protein PHAVU_009G242700g [Phaseolus vulgaris] ESW10843.1 hypothetical protein PHAVU_009G242700g [Phaseolus vulgaris] Length = 1048 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/53 (64%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGS+TEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 739 IGWIYGSITEDILTGFKMHCRGWKSVYCMPKRAAFKGSAPINLSDRLHQVLRW 791 >GAU43181.1 hypothetical protein TSUD_301470 [Trifolium subterraneum] Length = 910 Score = 71.2 bits (173), Expect = 6e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 601 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRPAFKGSAPINLSDRLHQVLRW 653 >KCW89002.1 hypothetical protein EUGRSUZ_A01324 [Eucalyptus grandis] Length = 924 Score = 71.2 bits (173), Expect = 6e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 615 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRPAFKGSAPINLSDRLHQVLRW 667 >AGJ71353.1 cellulose synthase 2, partial [Eucalyptus urophylla] Length = 998 Score = 71.2 bits (173), Expect = 6e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 689 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRPAFKGSAPINLSDRLHQVLRW 741 >XP_008339053.1 PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] [Malus domestica] Length = 1032 Score = 71.2 bits (173), Expect = 6e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 723 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRPAFKGSAPINLSDRLHQVLRW 775 >XP_015957971.1 PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic subunit 4 [UDP-forming]-like [Arachis duranensis] Length = 1033 Score = 71.2 bits (173), Expect = 6e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 724 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRPAFKGSAPINLSDRLHQVLRW 776 >XP_003532664.1 PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like [Glycine max] KRH42413.1 hypothetical protein GLYMA_08G088400 [Glycine max] Length = 1034 Score = 71.2 bits (173), Expect = 6e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 725 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRPAFKGSAPINLSDRLHQVLRW 777