BLASTX nr result
ID: Panax25_contig00026156
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00026156 (747 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVG91779.1 hypothetical protein Ccrd_026109 [Cynara cardunculus ... 60 1e-06 CAL90975.1 pescadillo-like protein [Zinnia violacea] 59 2e-06 KZM90916.1 hypothetical protein DCAR_021719 [Daucus carota subsp... 59 2e-06 XP_019231316.1 PREDICTED: pescadillo homolog [Nicotiana attenuat... 59 2e-06 XP_009782432.1 PREDICTED: pescadillo homolog [Nicotiana sylvestr... 59 2e-06 AGG84230.1 pescadillo [Nicotiana benthamiana] 59 2e-06 CDP02070.1 unnamed protein product [Coffea canephora] 59 2e-06 XP_017258626.1 PREDICTED: pescadillo homolog [Daucus carota subs... 59 2e-06 XP_016554524.1 PREDICTED: pescadillo homolog [Capsicum annuum] 59 2e-06 XP_015082357.1 PREDICTED: pescadillo homolog [Solanum pennellii] 59 2e-06 XP_006362998.1 PREDICTED: pescadillo homolog [Solanum tuberosum] 59 2e-06 XP_004243564.1 PREDICTED: pescadillo homolog [Solanum lycopersicum] 59 2e-06 >KVG91779.1 hypothetical protein Ccrd_026109 [Cynara cardunculus var. scolymus] Length = 551 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 741 HTCYHMTDIVFLKHEPLLPKFRDMGAYVRKIKESGIKKNR 622 HT YHM DI+FLKHEPLL KFR+M AY +K+K++ KKN+ Sbjct: 59 HTYYHMKDILFLKHEPLLEKFREMRAYEKKVKKAVSKKNK 98 >CAL90975.1 pescadillo-like protein [Zinnia violacea] Length = 583 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 741 HTCYHMTDIVFLKHEPLLPKFRDMGAYVRKIKESGIKKNR 622 HT YHM DI+FLKHEPLL KFR+M AY +K+K++ KKN+ Sbjct: 59 HTYYHMKDILFLKHEPLLDKFREMRAYEKKVKKAISKKNK 98 >KZM90916.1 hypothetical protein DCAR_021719 [Daucus carota subsp. sativus] Length = 595 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -1 Query: 741 HTCYHMTDIVFLKHEPLLPKFRDMGAYVRKIKESGIKKNR 622 HT YH+ DI FLKHEPL+ KFRDM Y RK+K++ KKNR Sbjct: 59 HTYYHVKDIAFLKHEPLVEKFRDMRTYDRKVKKAESKKNR 98 >XP_019231316.1 PREDICTED: pescadillo homolog [Nicotiana attenuata] OIT28838.1 pescadillo-like protein [Nicotiana attenuata] Length = 596 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 741 HTCYHMTDIVFLKHEPLLPKFRDMGAYVRKIKESGIKKNR 622 HT YH DI+FLKHEPLL KFR+M AY +KIK++ KKNR Sbjct: 59 HTYYHTKDILFLKHEPLLEKFREMRAYEKKIKKAVSKKNR 98 >XP_009782432.1 PREDICTED: pescadillo homolog [Nicotiana sylvestris] XP_016442771.1 PREDICTED: pescadillo homolog [Nicotiana tabacum] Length = 599 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 741 HTCYHMTDIVFLKHEPLLPKFRDMGAYVRKIKESGIKKNR 622 HT YH DI+FLKHEPLL KFR+M AY +KIK++ KKNR Sbjct: 59 HTYYHTKDILFLKHEPLLEKFREMRAYEKKIKKAVSKKNR 98 >AGG84230.1 pescadillo [Nicotiana benthamiana] Length = 599 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 741 HTCYHMTDIVFLKHEPLLPKFRDMGAYVRKIKESGIKKNR 622 HT YH DI+FLKHEPLL KFR+M AY +KIK++ KKNR Sbjct: 59 HTYYHTKDILFLKHEPLLEKFREMRAYEKKIKKAVSKKNR 98 >CDP02070.1 unnamed protein product [Coffea canephora] Length = 601 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -1 Query: 741 HTCYHMTDIVFLKHEPLLPKFRDMGAYVRKIKESGIKKNR 622 HT YHM DI+FLKHEPLL K R+M AY +K+K++ KKNR Sbjct: 59 HTYYHMKDILFLKHEPLLEKLREMRAYEKKVKKAQSKKNR 98 >XP_017258626.1 PREDICTED: pescadillo homolog [Daucus carota subsp. sativus] Length = 602 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -1 Query: 741 HTCYHMTDIVFLKHEPLLPKFRDMGAYVRKIKESGIKKNR 622 HT YH+ DI FLKHEPL+ KFRDM Y RK+K++ KKNR Sbjct: 59 HTYYHVKDIAFLKHEPLVEKFRDMRTYDRKVKKAESKKNR 98 >XP_016554524.1 PREDICTED: pescadillo homolog [Capsicum annuum] Length = 603 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 741 HTCYHMTDIVFLKHEPLLPKFRDMGAYVRKIKESGIKKNR 622 HT YH DI+FLKHEPLL KFR+M AY +KIK++ KKNR Sbjct: 59 HTYYHTKDILFLKHEPLLEKFREMRAYEKKIKKAVSKKNR 98 >XP_015082357.1 PREDICTED: pescadillo homolog [Solanum pennellii] Length = 603 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 741 HTCYHMTDIVFLKHEPLLPKFRDMGAYVRKIKESGIKKNR 622 HT YH DI+FLKHEPLL KFR+M AY +KIK++ KKNR Sbjct: 59 HTYYHTKDILFLKHEPLLEKFREMRAYEKKIKKAVSKKNR 98 >XP_006362998.1 PREDICTED: pescadillo homolog [Solanum tuberosum] Length = 603 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 741 HTCYHMTDIVFLKHEPLLPKFRDMGAYVRKIKESGIKKNR 622 HT YH DI+FLKHEPLL KFR+M AY +KIK++ KKNR Sbjct: 59 HTYYHTKDILFLKHEPLLEKFREMRAYEKKIKKAVSKKNR 98 >XP_004243564.1 PREDICTED: pescadillo homolog [Solanum lycopersicum] Length = 603 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 741 HTCYHMTDIVFLKHEPLLPKFRDMGAYVRKIKESGIKKNR 622 HT YH DI+FLKHEPLL KFR+M AY +KIK++ KKNR Sbjct: 59 HTYYHTKDILFLKHEPLLEKFREMRAYEKKIKKAVSKKNR 98