BLASTX nr result
ID: Panax25_contig00025954
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00025954 (432 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP03685.1 unnamed protein product [Coffea canephora] 64 4e-09 XP_017243028.1 PREDICTED: guanylate-binding protein 5-like [Dauc... 58 5e-07 XP_019247970.1 PREDICTED: guanylate-binding protein 4 [Nicotiana... 57 7e-07 XP_009776899.1 PREDICTED: guanylate-binding protein 4-like [Nico... 57 7e-07 XP_009596370.1 PREDICTED: guanylate-binding protein 4 [Nicotiana... 57 7e-07 XP_019188541.1 PREDICTED: guanylate-binding protein 7 isoform X2... 56 2e-06 XP_019188539.1 PREDICTED: guanylate-binding protein 4 isoform X1... 56 2e-06 XP_015166550.1 PREDICTED: guanylate-binding protein 5-like isofo... 56 2e-06 XP_015166549.1 PREDICTED: guanylate-binding protein 5-like isofo... 56 2e-06 XP_016565442.1 PREDICTED: guanylate-binding protein 4-like isofo... 55 4e-06 XP_015088514.1 PREDICTED: guanylate-binding protein 4 isoform X1... 55 4e-06 XP_015165195.1 PREDICTED: guanylate-binding protein 4 [Solanum t... 55 4e-06 XP_004247208.1 PREDICTED: guanylate-binding protein 4 [Solanum l... 55 4e-06 >CDP03685.1 unnamed protein product [Coffea canephora] Length = 600 Score = 63.9 bits (154), Expect = 4e-09 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -2 Query: 431 YWRCYGRINHGPGWLLPMYNNPKDRRRSE 345 YWRCYGR HGP WLLP+YNNPKDRRRSE Sbjct: 572 YWRCYGRKKHGPRWLLPVYNNPKDRRRSE 600 >XP_017243028.1 PREDICTED: guanylate-binding protein 5-like [Daucus carota subsp. sativus] Length = 600 Score = 57.8 bits (138), Expect = 5e-07 Identities = 25/30 (83%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = -2 Query: 431 YWRCYGRINHGPGWLLPMY-NNPKDRRRSE 345 YWRCYGR HG WLLPMY NNPKDRRRSE Sbjct: 571 YWRCYGRRKHGSQWLLPMYNNNPKDRRRSE 600 >XP_019247970.1 PREDICTED: guanylate-binding protein 4 [Nicotiana attenuata] OIT08160.1 hypothetical protein A4A49_17401 [Nicotiana attenuata] Length = 599 Score = 57.4 bits (137), Expect = 7e-07 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = -2 Query: 431 YWRCYGRINHGPGWLLPMYNNPKDRRRSE 345 YWRCYGR HGP WLLP+Y+NPKD+ R+E Sbjct: 571 YWRCYGRRKHGPRWLLPVYSNPKDQHRTE 599 >XP_009776899.1 PREDICTED: guanylate-binding protein 4-like [Nicotiana sylvestris] XP_016484655.1 PREDICTED: guanylate-binding protein 4-like [Nicotiana tabacum] Length = 599 Score = 57.4 bits (137), Expect = 7e-07 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = -2 Query: 431 YWRCYGRINHGPGWLLPMYNNPKDRRRSE 345 YWRCYGR HGP WLLP+Y+NPKD+ R+E Sbjct: 571 YWRCYGRRKHGPRWLLPVYSNPKDQHRTE 599 >XP_009596370.1 PREDICTED: guanylate-binding protein 4 [Nicotiana tomentosiformis] XP_016507229.1 PREDICTED: guanylate-binding protein 4-like [Nicotiana tabacum] Length = 599 Score = 57.4 bits (137), Expect = 7e-07 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = -2 Query: 431 YWRCYGRINHGPGWLLPMYNNPKDRRRSE 345 YWRCYGR HGP WLLP+Y+NPKD+ R+E Sbjct: 571 YWRCYGRRKHGPRWLLPVYSNPKDQHRTE 599 >XP_019188541.1 PREDICTED: guanylate-binding protein 7 isoform X2 [Ipomoea nil] Length = 548 Score = 56.2 bits (134), Expect = 2e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -2 Query: 431 YWRCYGRINHGPGWLLPMYNNPKDRRRSE 345 YWRCYGR +G WLLP+Y+NPKDRRRSE Sbjct: 520 YWRCYGRRKNGARWLLPVYSNPKDRRRSE 548 >XP_019188539.1 PREDICTED: guanylate-binding protein 4 isoform X1 [Ipomoea nil] Length = 600 Score = 56.2 bits (134), Expect = 2e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -2 Query: 431 YWRCYGRINHGPGWLLPMYNNPKDRRRSE 345 YWRCYGR +G WLLP+Y+NPKDRRRSE Sbjct: 572 YWRCYGRRKNGARWLLPVYSNPKDRRRSE 600 >XP_015166550.1 PREDICTED: guanylate-binding protein 5-like isoform X2 [Solanum tuberosum] Length = 610 Score = 56.2 bits (134), Expect = 2e-06 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = -2 Query: 431 YWRCYGRINHGPGWLLPMYNNPKDRRRSE 345 YWRCYGR+ HGP W LP+Y+N KD+RRSE Sbjct: 582 YWRCYGRMQHGPRWSLPVYSNRKDQRRSE 610 >XP_015166549.1 PREDICTED: guanylate-binding protein 5-like isoform X1 [Solanum tuberosum] Length = 651 Score = 56.2 bits (134), Expect = 2e-06 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = -2 Query: 431 YWRCYGRINHGPGWLLPMYNNPKDRRRSE 345 YWRCYGR+ HGP W LP+Y+N KD+RRSE Sbjct: 623 YWRCYGRMQHGPRWSLPVYSNRKDQRRSE 651 >XP_016565442.1 PREDICTED: guanylate-binding protein 4-like isoform X1 [Capsicum annuum] Length = 599 Score = 55.1 bits (131), Expect = 4e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 431 YWRCYGRINHGPGWLLPMYNNPKDRRRSE 345 YWRCYGR HG WLLPMYNN KDR R+E Sbjct: 571 YWRCYGRRKHGSIWLLPMYNNHKDRHRTE 599 >XP_015088514.1 PREDICTED: guanylate-binding protein 4 isoform X1 [Solanum pennellii] Length = 600 Score = 55.1 bits (131), Expect = 4e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -2 Query: 431 YWRCYGRINHGPGWLLPMYNNPKDRRRSE 345 YWRCYGR HGP LLPMY+NPKDR R+E Sbjct: 572 YWRCYGRRKHGPMLLLPMYSNPKDRHRTE 600 >XP_015165195.1 PREDICTED: guanylate-binding protein 4 [Solanum tuberosum] Length = 600 Score = 55.1 bits (131), Expect = 4e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -2 Query: 431 YWRCYGRINHGPGWLLPMYNNPKDRRRSE 345 YWRCYGR HGP LLPMY+NPKDR R+E Sbjct: 572 YWRCYGRRKHGPMLLLPMYSNPKDRHRTE 600 >XP_004247208.1 PREDICTED: guanylate-binding protein 4 [Solanum lycopersicum] Length = 600 Score = 55.1 bits (131), Expect = 4e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -2 Query: 431 YWRCYGRINHGPGWLLPMYNNPKDRRRSE 345 YWRCYGR HGP LLPMY+NPKDR R+E Sbjct: 572 YWRCYGRRKHGPMLLLPMYSNPKDRHRTE 600