BLASTX nr result
ID: Panax25_contig00025898
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00025898 (1092 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016466206.1 PREDICTED: 60S ribosomal protein L7-2-like [Nicot... 80 8e-14 XP_009760598.1 PREDICTED: 60S ribosomal protein L7-2-like [Nicot... 80 8e-14 XP_019233863.1 PREDICTED: 60S ribosomal protein L7-2-like [Nicot... 80 1e-13 XP_009594643.1 PREDICTED: 60S ribosomal protein L7-2-like [Nicot... 79 3e-13 XP_011073347.1 PREDICTED: 60S ribosomal protein L7-1 [Sesamum in... 78 8e-13 KZV22611.1 hypothetical protein F511_02628 [Dorcoceras hygrometr... 78 8e-13 KVI06062.1 Ribosomal protein L30, ferredoxin-like fold domain-co... 77 1e-12 XP_019167451.1 PREDICTED: 60S ribosomal protein L7-2-like [Ipomo... 77 1e-12 XP_006495350.1 PREDICTED: 60S ribosomal protein L7-1-like [Citru... 74 2e-12 XP_007011052.2 PREDICTED: 60S ribosomal protein L7-1 [Theobroma ... 77 2e-12 XP_012856581.1 PREDICTED: 60S ribosomal protein L7-1 [Erythranth... 77 2e-12 XP_016728050.1 PREDICTED: 60S ribosomal protein L7-1-like [Gossy... 77 2e-12 XP_012460025.1 PREDICTED: 60S ribosomal protein L7-1-like [Gossy... 77 2e-12 XP_002272916.1 PREDICTED: 60S ribosomal protein L7-2 [Vitis vini... 76 3e-12 EOY19862.1 Ribosomal protein L30/L7 family protein isoform 1 [Th... 76 3e-12 XP_012457113.1 PREDICTED: 60S ribosomal protein L7-1-like [Gossy... 76 3e-12 XP_016699774.1 PREDICTED: 60S ribosomal protein L7-1-like [Gossy... 76 4e-12 XP_017647303.1 PREDICTED: 60S ribosomal protein L7-1-like [Gossy... 75 5e-12 KHG15155.1 60S ribosomal L7-1 -like protein [Gossypium arboreum] 75 5e-12 XP_015079410.1 PREDICTED: 60S ribosomal protein L7-2-like [Solan... 75 6e-12 >XP_016466206.1 PREDICTED: 60S ribosomal protein L7-2-like [Nicotiana tabacum] Length = 246 Score = 80.5 bits (197), Expect = 8e-14 Identities = 40/52 (76%), Positives = 44/52 (84%) Frame = -3 Query: 934 IPIFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 I +F K+DMHPKTRK+LYSLRLRKIFSGVFVKAN RIM+ILQKVEPY Sbjct: 86 ILLFVIRVGGKSDMHPKTRKLLYSLRLRKIFSGVFVKANARIMEILQKVEPY 137 >XP_009760598.1 PREDICTED: 60S ribosomal protein L7-2-like [Nicotiana sylvestris] Length = 246 Score = 80.5 bits (197), Expect = 8e-14 Identities = 40/52 (76%), Positives = 44/52 (84%) Frame = -3 Query: 934 IPIFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 I +F K+DMHPKTRK+LYSLRLRKIFSGVFVKAN RIM+ILQKVEPY Sbjct: 86 ILLFVIRVGGKSDMHPKTRKLLYSLRLRKIFSGVFVKANARIMEILQKVEPY 137 >XP_019233863.1 PREDICTED: 60S ribosomal protein L7-2-like [Nicotiana attenuata] OIT27109.1 60s ribosomal protein l7-1 [Nicotiana attenuata] Length = 246 Score = 80.1 bits (196), Expect = 1e-13 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -3 Query: 904 KNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 K+DMHPKTRK+LYSLRLRKIFSGVFVKAN RIM+ILQKVEPY Sbjct: 96 KSDMHPKTRKLLYSLRLRKIFSGVFVKANARIMEILQKVEPY 137 >XP_009594643.1 PREDICTED: 60S ribosomal protein L7-2-like [Nicotiana tomentosiformis] XP_016441760.1 PREDICTED: 60S ribosomal protein L7-2-like [Nicotiana tabacum] Length = 246 Score = 79.0 bits (193), Expect = 3e-13 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -3 Query: 904 KNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 K+DMHP+TRK+LYSLRLRKIFSGVFVKAN RIM+ILQKVEPY Sbjct: 96 KSDMHPRTRKLLYSLRLRKIFSGVFVKANARIMEILQKVEPY 137 >XP_011073347.1 PREDICTED: 60S ribosomal protein L7-1 [Sesamum indicum] XP_011073348.1 PREDICTED: 60S ribosomal protein L7-1 [Sesamum indicum] XP_011073349.1 PREDICTED: 60S ribosomal protein L7-1 [Sesamum indicum] Length = 247 Score = 77.8 bits (190), Expect = 8e-13 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -3 Query: 928 IFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 +F KNDMHPKTRK+LYSLRLRKIFSGVFVKA++ +M+ILQKVEPY Sbjct: 89 LFVIRIGGKNDMHPKTRKMLYSLRLRKIFSGVFVKASEGMMEILQKVEPY 138 >KZV22611.1 hypothetical protein F511_02628 [Dorcoceras hygrometricum] Length = 248 Score = 77.8 bits (190), Expect = 8e-13 Identities = 35/42 (83%), Positives = 42/42 (100%) Frame = -3 Query: 904 KNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 KNDMHP+TRK+L+SLRLRKIFSGVFVKAN+R+M+IL+KVEPY Sbjct: 98 KNDMHPQTRKLLHSLRLRKIFSGVFVKANERLMEILRKVEPY 139 >KVI06062.1 Ribosomal protein L30, ferredoxin-like fold domain-containing protein [Cynara cardunculus var. scolymus] Length = 246 Score = 77.4 bits (189), Expect = 1e-12 Identities = 35/42 (83%), Positives = 42/42 (100%) Frame = -3 Query: 904 KNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 K+DMHP+TRK+LYSLRLR+IFSGVFVKAN+RI++ILQKVEPY Sbjct: 88 KSDMHPQTRKLLYSLRLRRIFSGVFVKANNRILEILQKVEPY 129 >XP_019167451.1 PREDICTED: 60S ribosomal protein L7-2-like [Ipomoea nil] Length = 248 Score = 77.4 bits (189), Expect = 1e-12 Identities = 40/61 (65%), Positives = 47/61 (77%) Frame = -3 Query: 961 PICMQFLFVIPIFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEP 782 P + LFVI I KNDMHPKTRK+LYSLRLR++F+GVF+KAN+R M ILQKVEP Sbjct: 84 PPTSKLLFVIRI-----GGKNDMHPKTRKLLYSLRLRRVFNGVFLKANERTMGILQKVEP 138 Query: 781 Y 779 Y Sbjct: 139 Y 139 >XP_006495350.1 PREDICTED: 60S ribosomal protein L7-1-like [Citrus sinensis] Length = 146 Score = 74.3 bits (181), Expect = 2e-12 Identities = 33/50 (66%), Positives = 43/50 (86%) Frame = -3 Query: 928 IFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 +F Q +DMHPKT+KILY+LRLR+IFSGVFV+AND ++++LQKVEPY Sbjct: 93 LFIIRIQGTSDMHPKTKKILYNLRLRRIFSGVFVRANDGMLEVLQKVEPY 142 >XP_007011052.2 PREDICTED: 60S ribosomal protein L7-1 [Theobroma cacao] XP_007011053.2 PREDICTED: 60S ribosomal protein L7-1 [Theobroma cacao] Length = 250 Score = 76.6 bits (187), Expect = 2e-12 Identities = 34/50 (68%), Positives = 43/50 (86%) Frame = -3 Query: 928 IFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 +F Q KNDMHPKTRKILY+LRLR++FSGVFVKA + ++++LQKVEPY Sbjct: 92 LFVIRIQGKNDMHPKTRKILYNLRLRRVFSGVFVKATEGVIEMLQKVEPY 141 >XP_012856581.1 PREDICTED: 60S ribosomal protein L7-1 [Erythranthe guttata] EYU21709.1 hypothetical protein MIMGU_mgv1a012454mg [Erythranthe guttata] EYU21710.1 hypothetical protein MIMGU_mgv1a012454mg [Erythranthe guttata] EYU21711.1 hypothetical protein MIMGU_mgv1a012454mg [Erythranthe guttata] EYU21712.1 hypothetical protein MIMGU_mgv1a012454mg [Erythranthe guttata] Length = 250 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = -3 Query: 928 IFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 +F + KNDMHPK+RK+LYSLRLRKIFSGVFVKA+ +M+ILQKVEPY Sbjct: 92 LFVIRIRGKNDMHPKSRKLLYSLRLRKIFSGVFVKASKGMMEILQKVEPY 141 >XP_016728050.1 PREDICTED: 60S ribosomal protein L7-1-like [Gossypium hirsutum] XP_017616050.1 PREDICTED: 60S ribosomal protein L7-1-like [Gossypium arboreum] Length = 252 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = -3 Query: 928 IFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 +F Q KNDMHPKTRKILY+LRLRK+FSGVFVKA + ++ +LQKVEPY Sbjct: 93 LFIIRIQGKNDMHPKTRKILYNLRLRKVFSGVFVKATEGVIDMLQKVEPY 142 >XP_012460025.1 PREDICTED: 60S ribosomal protein L7-1-like [Gossypium raimondii] XP_016724384.1 PREDICTED: 60S ribosomal protein L7-1-like [Gossypium hirsutum] KJB74949.1 hypothetical protein B456_012G017500 [Gossypium raimondii] KJB74950.1 hypothetical protein B456_012G017500 [Gossypium raimondii] KJB74951.1 hypothetical protein B456_012G017500 [Gossypium raimondii] Length = 252 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = -3 Query: 928 IFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 +F Q KNDMHPKTRKILY+LRLRK+FSGVFVKA + ++ +LQKVEPY Sbjct: 93 LFIIRIQGKNDMHPKTRKILYNLRLRKVFSGVFVKATEGVIDMLQKVEPY 142 >XP_002272916.1 PREDICTED: 60S ribosomal protein L7-2 [Vitis vinifera] CBI38935.3 unnamed protein product, partial [Vitis vinifera] Length = 246 Score = 76.3 bits (186), Expect = 3e-12 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = -3 Query: 928 IFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 +F Q KNDMHPKTRKILY LRLRKIF GV VKAN+ I+++LQKVEPY Sbjct: 88 LFVIRIQGKNDMHPKTRKILYFLRLRKIFDGVLVKANEGILEMLQKVEPY 137 >EOY19862.1 Ribosomal protein L30/L7 family protein isoform 1 [Theobroma cacao] EOY19863.1 Ribosomal protein L30/L7 family protein isoform 1 [Theobroma cacao] Length = 250 Score = 76.3 bits (186), Expect = 3e-12 Identities = 33/50 (66%), Positives = 43/50 (86%) Frame = -3 Query: 928 IFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 +F Q KNDMHPKTRKILY+LRLR++FSG+FVKA + ++++LQKVEPY Sbjct: 92 LFVIRIQGKNDMHPKTRKILYNLRLRRVFSGIFVKATEGVIEMLQKVEPY 141 >XP_012457113.1 PREDICTED: 60S ribosomal protein L7-1-like [Gossypium raimondii] KJB73093.1 hypothetical protein B456_011G214200 [Gossypium raimondii] Length = 252 Score = 76.3 bits (186), Expect = 3e-12 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = -3 Query: 928 IFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 +F Q KNDMHPKTRKILY+L LRK+FSGVFVKA + +M++LQKVEPY Sbjct: 93 LFVIRLQGKNDMHPKTRKILYNLGLRKLFSGVFVKATEGVMEMLQKVEPY 142 >XP_016699774.1 PREDICTED: 60S ribosomal protein L7-1-like [Gossypium hirsutum] Length = 252 Score = 75.9 bits (185), Expect = 4e-12 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = -3 Query: 928 IFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 +F Q KNDMHPKTRKILY+L LRK+FSGVFVKA + +M++LQKVEPY Sbjct: 93 LFIIRLQGKNDMHPKTRKILYNLGLRKLFSGVFVKATEGVMEMLQKVEPY 142 >XP_017647303.1 PREDICTED: 60S ribosomal protein L7-1-like [Gossypium arboreum] Length = 252 Score = 75.5 bits (184), Expect = 5e-12 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -3 Query: 928 IFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 +F Q KNDMHPKTRKILY+L +RK+FSGVFVKA + +M++LQKVEPY Sbjct: 93 LFVIRLQGKNDMHPKTRKILYNLGMRKLFSGVFVKATEGVMEMLQKVEPY 142 >KHG15155.1 60S ribosomal L7-1 -like protein [Gossypium arboreum] Length = 252 Score = 75.5 bits (184), Expect = 5e-12 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -3 Query: 928 IFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 +F Q KNDMHPKTRKILY+L +RK+FSGVFVKA + +M++LQKVEPY Sbjct: 93 LFVIRLQGKNDMHPKTRKILYNLGMRKLFSGVFVKATEGVMEMLQKVEPY 142 >XP_015079410.1 PREDICTED: 60S ribosomal protein L7-2-like [Solanum pennellii] Length = 246 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = -3 Query: 928 IFTCDFQKKNDMHPKTRKILYSLRLRKIFSGVFVKANDRIMQILQKVEPY 779 +F K+DMHP+TRK LYSLRLRKIFSGVFVKAN+R ++ILQKVEP+ Sbjct: 88 LFVIRIGGKSDMHPRTRKALYSLRLRKIFSGVFVKANERTLEILQKVEPF 137