BLASTX nr result
ID: Panax25_contig00025873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00025873 (967 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012077770.1 PREDICTED: putative F-box protein At1g58310 [Jatr... 65 3e-08 >XP_012077770.1 PREDICTED: putative F-box protein At1g58310 [Jatropha curcas] XP_012077771.1 PREDICTED: putative F-box protein At1g58310 [Jatropha curcas] KDP33224.1 hypothetical protein JCGZ_12746 [Jatropha curcas] Length = 373 Score = 65.1 bits (157), Expect = 3e-08 Identities = 55/166 (33%), Positives = 91/166 (54%), Gaps = 9/166 (5%) Frame = +2 Query: 41 GLTALETLCLEDFDIVNYNHPLDIFSSLQNLKELILVGCWIYGKDDSFNISAPGLERLTI 220 GL +L+TL L DF N ++ S+ NL+ LIL G ++YG SFNI+AP L+ L + Sbjct: 170 GLPSLKTLHLVDFG----NFDGNVLSTCPNLETLILEGLYLYGIK-SFNINAPNLKTLVL 224 Query: 221 LHKVNSIPRRYVKLRISSPTL---KYLRLDLWAGDISVCNQHFLEELEINVHPYK---DL 382 + I K IS+P L K+ +L A SV N + L+E++ ++ ++ D Sbjct: 225 --DIREIDHGDPKFSISAPKLTKFKFATAELAA--FSVNNLNSLDEVDFDLMIFQFDLDE 280 Query: 383 EKIFFYESFVK---NLIKVFGSLSHAKSATISQSTLQVLSTFLDFL 511 ++ + E++ K +L+ + +AKS T+S+ ++VLS F D L Sbjct: 281 TRLKYLETYRKICLDLVNMLKGFRNAKSITLSRDAIEVLSLFPDIL 326