BLASTX nr result
ID: Panax25_contig00025838
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00025838 (424 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017237668.1 PREDICTED: CDT1-like protein a, chloroplastic [Da... 54 2e-11 KZN02654.1 hypothetical protein DCAR_011408 [Daucus carota subsp... 54 2e-11 KVI07283.1 CDT1 Geminin-binding domain-like protein [Cynara card... 43 9e-06 >XP_017237668.1 PREDICTED: CDT1-like protein a, chloroplastic [Daucus carota subsp. sativus] XP_017237669.1 PREDICTED: CDT1-like protein a, chloroplastic [Daucus carota subsp. sativus] Length = 510 Score = 54.3 bits (129), Expect(2) = 2e-11 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = +2 Query: 38 NVQPAVEKRSDLESNILSRTPAKANETLPIKHKTEAGELPEKWVSQKKI 184 N K SDL+S++LSRTPAKANETLP + + EA ELP+K+ + ++ Sbjct: 17 NFDSTTVKSSDLQSDVLSRTPAKANETLPSRDRREATELPQKYKTMAEV 65 Score = 41.6 bits (96), Expect(2) = 2e-11 Identities = 20/41 (48%), Positives = 26/41 (63%) Frame = +3 Query: 258 RYKTISEFFDRMTXXXXXXXXXXXXPTFKNICSQVQILSGR 380 +YKT++E F+RMT PTFKN+ SQVQIL+ R Sbjct: 58 KYKTMAEVFNRMTSSLRLLSLRKKSPTFKNVSSQVQILARR 98 >KZN02654.1 hypothetical protein DCAR_011408 [Daucus carota subsp. sativus] Length = 507 Score = 54.3 bits (129), Expect(2) = 2e-11 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = +2 Query: 38 NVQPAVEKRSDLESNILSRTPAKANETLPIKHKTEAGELPEKWVSQKKI 184 N K SDL+S++LSRTPAKANETLP + + EA ELP+K+ + ++ Sbjct: 17 NFDSTTVKSSDLQSDVLSRTPAKANETLPSRDRREATELPQKYKTMAEV 65 Score = 41.6 bits (96), Expect(2) = 2e-11 Identities = 20/41 (48%), Positives = 26/41 (63%) Frame = +3 Query: 258 RYKTISEFFDRMTXXXXXXXXXXXXPTFKNICSQVQILSGR 380 +YKT++E F+RMT PTFKN+ SQVQIL+ R Sbjct: 58 KYKTMAEVFNRMTSSLRLLSLRKKSPTFKNVSSQVQILARR 98 >KVI07283.1 CDT1 Geminin-binding domain-like protein [Cynara cardunculus var. scolymus] Length = 579 Score = 42.7 bits (99), Expect(2) = 9e-06 Identities = 20/41 (48%), Positives = 25/41 (60%) Frame = +3 Query: 258 RYKTISEFFDRMTXXXXXXXXXXXXPTFKNICSQVQILSGR 380 +Y T+SEFFDRMT PTF+NIC QV+ L+ R Sbjct: 173 KYGTLSEFFDRMTTSLRLLNLHKQLPTFQNICRQVETLTKR 213 Score = 33.9 bits (76), Expect(2) = 9e-06 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +2 Query: 71 LESNILSRTPAKANETLPIKHKTEAGELPEKW 166 L++N ++ TP K ETL I+ K E +LPEK+ Sbjct: 143 LDANFVTPTPEKTEETLNIRCKKEPAKLPEKY 174