BLASTX nr result
ID: Panax25_contig00025828
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00025828 (749 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDO99760.1 unnamed protein product [Coffea canephora] 58 5e-06 >CDO99760.1 unnamed protein product [Coffea canephora] Length = 2571 Score = 58.2 bits (139), Expect = 5e-06 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = -1 Query: 137 ILQFFLLLQRATPIVLEGSFDFFKVFPSNALALPTILQQSLLGRL 3 +L F + R P +EGSFDFFKV PSN LALPTILQQS+L L Sbjct: 612 LLDVFRIYHRTLPTAVEGSFDFFKVLPSNPLALPTILQQSMLSLL 656