BLASTX nr result
ID: Panax25_contig00025640
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00025640 (459 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017243072.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 70 2e-11 KZN01685.1 hypothetical protein DCAR_010439 [Daucus carota subsp... 70 2e-11 XP_008386232.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 69 1e-10 XP_009371429.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 68 1e-10 CBI28125.3 unnamed protein product, partial [Vitis vinifera] 67 4e-10 GAV92051.1 Acyl-ACP_TE domain-containing protein/Acyl-thio_N dom... 67 4e-10 XP_019078669.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 67 4e-10 KZN03334.1 hypothetical protein DCAR_012090 [Daucus carota subsp... 66 7e-10 OAY21900.1 hypothetical protein MANES_S047300 [Manihot esculenta] 66 9e-10 ACQ57190.1 acyl acyl-carrier-protein thioesterase type B, partia... 66 1e-09 XP_007013278.2 PREDICTED: palmitoyl-acyl carrier protein thioest... 65 1e-09 EOY30897.1 Fatty acyl-ACP thioesterases B isoform 2 [Theobroma c... 65 1e-09 EOY30896.1 Fatty acyl-ACP thioesterases B isoform 1 [Theobroma c... 65 1e-09 ACQ63293.1 acyl acyl-carrier-protein thioesterase type B, partia... 65 1e-09 XP_010688133.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 65 2e-09 AIX97815.1 fatty acyl-ACP thioesterase B [Prunus sibirica] 65 2e-09 XP_008242683.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 65 2e-09 XP_007202158.1 hypothetical protein PRUPE_ppa006328mg [Prunus pe... 65 2e-09 JAT50763.1 Myristoyl-acyl carrier protein thioesterase, chloropl... 65 2e-09 XP_009374053.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 64 3e-09 >XP_017243072.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Daucus carota subsp. sativus] XP_017243073.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Daucus carota subsp. sativus] Length = 418 Score = 70.5 bits (171), Expect = 2e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRL+DGAEIVKGRTEWRPK +Y IGS G LPAES Sbjct: 380 CQHLLRLKDGAEIVKGRTEWRPKRSYRIGSFGQLPAES 417 >KZN01685.1 hypothetical protein DCAR_010439 [Daucus carota subsp. sativus] Length = 435 Score = 70.5 bits (171), Expect = 2e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRL+DGAEIVKGRTEWRPK +Y IGS G LPAES Sbjct: 397 CQHLLRLKDGAEIVKGRTEWRPKRSYRIGSFGQLPAES 434 >XP_008386232.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Malus domestica] XP_008362927.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Malus domestica] Length = 415 Score = 68.6 bits (166), Expect = 1e-10 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQH+LRLEDGAEIV+GRTEWRPK A +G +GHLPAES Sbjct: 377 CQHMLRLEDGAEIVRGRTEWRPKYANNLGIVGHLPAES 414 >XP_009371429.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Pyrus x bretschneideri] Length = 415 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQH+LRLEDGAEIV+GRTEWRPK A +G +GHLPAES Sbjct: 377 CQHMLRLEDGAEIVRGRTEWRPKYANDLGIVGHLPAES 414 >CBI28125.3 unnamed protein product, partial [Vitis vinifera] Length = 408 Score = 67.0 bits (162), Expect = 4e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRLE+GAEIVKGRTEWRPK A+ +G +G +PAES Sbjct: 370 CQHLLRLEEGAEIVKGRTEWRPKYAHSMGGVGQIPAES 407 >GAV92051.1 Acyl-ACP_TE domain-containing protein/Acyl-thio_N domain-containing protein [Cephalotus follicularis] Length = 421 Score = 67.0 bits (162), Expect = 4e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRLEDGAEIV+GRTEWRPK A G+LG +PAES Sbjct: 383 CQHLLRLEDGAEIVRGRTEWRPKYANNFGTLGQIPAES 420 >XP_019078669.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Vitis vinifera] Length = 421 Score = 67.0 bits (162), Expect = 4e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRLE+GAEIVKGRTEWRPK A+ +G +G +PAES Sbjct: 383 CQHLLRLEEGAEIVKGRTEWRPKYAHSMGGVGQIPAES 420 >KZN03334.1 hypothetical protein DCAR_012090 [Daucus carota subsp. sativus] Length = 411 Score = 66.2 bits (160), Expect = 7e-10 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRLEDG +IVKGRTEWRPK +YG+ S LPAES Sbjct: 373 CQHLLRLEDGGDIVKGRTEWRPKRSYGVKSFDQLPAES 410 >OAY21900.1 hypothetical protein MANES_S047300 [Manihot esculenta] Length = 418 Score = 65.9 bits (159), Expect = 9e-10 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRLEDGAEIV+GRTEWRPK A G +G LPAES Sbjct: 380 CQHLLRLEDGAEIVRGRTEWRPKYASNFGIMGQLPAES 417 >ACQ57190.1 acyl acyl-carrier-protein thioesterase type B, partial [Camellia oleifera] Length = 434 Score = 65.9 bits (159), Expect = 1e-09 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRLE GAEIVKGRTEWRPK A +G+LG LPAES Sbjct: 396 CQHLLRLEGGAEIVKGRTEWRPKYANCVGTLGSLPAES 433 >XP_007013278.2 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Theobroma cacao] Length = 420 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRLEDG+EIV+GRTEWRPK A G++G LPAES Sbjct: 382 CQHLLRLEDGSEIVRGRTEWRPKYAKSFGNVGQLPAES 419 >EOY30897.1 Fatty acyl-ACP thioesterases B isoform 2 [Theobroma cacao] Length = 420 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRLEDG+EIV+GRTEWRPK A G++G LPAES Sbjct: 382 CQHLLRLEDGSEIVRGRTEWRPKYAKSFGNVGQLPAES 419 >EOY30896.1 Fatty acyl-ACP thioesterases B isoform 1 [Theobroma cacao] Length = 426 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRLEDG+EIV+GRTEWRPK A G++G LPAES Sbjct: 388 CQHLLRLEDGSEIVRGRTEWRPKYAKSFGNVGQLPAES 425 >ACQ63293.1 acyl acyl-carrier-protein thioesterase type B, partial [Camellia oleifera] Length = 434 Score = 65.5 bits (158), Expect = 1e-09 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRLE GAEIVKGRTEWRPK A +G+LG LPAES Sbjct: 396 CQHLLRLEGGAEIVKGRTEWRPKYANCLGTLGSLPAES 433 >XP_010688133.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Beta vulgaris subsp. vulgaris] XP_010688134.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Beta vulgaris subsp. vulgaris] XP_019106990.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Beta vulgaris subsp. vulgaris] KMT02998.1 hypothetical protein BVRB_8g195640 [Beta vulgaris subsp. vulgaris] Length = 421 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRLEDGAE+++GRTEWRPK A G LG +PAES Sbjct: 383 CQHLLRLEDGAEVMRGRTEWRPKHAKNFGKLGQVPAES 420 >AIX97815.1 fatty acyl-ACP thioesterase B [Prunus sibirica] Length = 417 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRLE+GAEIV+GRTEWRPK A +G +G LPAES Sbjct: 379 CQHLLRLEEGAEIVRGRTEWRPKYANNLGIVGQLPAES 416 >XP_008242683.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Prunus mume] XP_008242684.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Prunus mume] XP_016651836.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Prunus mume] Length = 417 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRLE+GAEIV+GRTEWRPK A +G +G LPAES Sbjct: 379 CQHLLRLEEGAEIVRGRTEWRPKYANNLGIVGQLPAES 416 >XP_007202158.1 hypothetical protein PRUPE_ppa006328mg [Prunus persica] ONH98189.1 hypothetical protein PRUPE_7G234600 [Prunus persica] ONH98190.1 hypothetical protein PRUPE_7G234600 [Prunus persica] ONH98191.1 hypothetical protein PRUPE_7G234600 [Prunus persica] Length = 417 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQHLLRLE+GAEIV+GRTEWRPK A +G +G LPAES Sbjct: 379 CQHLLRLEEGAEIVRGRTEWRPKYANNLGIVGQLPAES 416 >JAT50763.1 Myristoyl-acyl carrier protein thioesterase, chloroplastic [Anthurium amnicola] Length = 426 Score = 64.7 bits (156), Expect = 2e-09 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 C+HLLRLE GAEIV+GRTEWRPK A GS GHLPAES Sbjct: 388 CEHLLRLEAGAEIVRGRTEWRPKPARDWGSTGHLPAES 425 >XP_009374053.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Pyrus x bretschneideri] Length = 415 Score = 64.3 bits (155), Expect = 3e-09 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +3 Query: 3 CQHLLRLEDGAEIVKGRTEWRPKGAYGIGSLGHLPAES 116 CQH+LRLE+GAEIV+GRTEW+PK A +G +GHLP ES Sbjct: 377 CQHMLRLEEGAEIVRGRTEWKPKYANNLGIVGHLPGES 414