BLASTX nr result
ID: Panax25_contig00025544
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00025544 (390 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017233475.1 PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [... 59 1e-07 XP_017217910.1 PREDICTED: ubiquitin-like-specific protease 1A [D... 57 3e-07 XP_017257223.1 PREDICTED: ubiquitin-like-specific protease 1A [D... 57 3e-07 XP_017239691.1 PREDICTED: uncharacterized protein LOC108212478 [... 58 4e-07 XP_017239388.1 PREDICTED: ubiquitin-like-specific protease 1A [D... 57 4e-07 XP_017217396.1 PREDICTED: uncharacterized protein LOC108194972 [... 57 4e-07 XP_017246770.1 PREDICTED: putative ubiquitin-like-specific prote... 54 2e-06 KZM80533.1 hypothetical protein DCAR_032179 [Daucus carota subsp... 55 4e-06 XP_017222790.1 PREDICTED: putative ubiquitin-like-specific prote... 52 6e-06 >XP_017233475.1 PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Daucus carota subsp. sativus] Length = 656 Score = 58.9 bits (141), Expect = 1e-07 Identities = 27/71 (38%), Positives = 44/71 (61%) Frame = -3 Query: 361 WPKSKPKVEACVNRPRQ*NEDDCGIYVAKYVDFFLHRINIMEEPRWILNEAYNFRFRIAH 182 +P+ ++ A + RP+Q N DCGI+V KY+D+ L + ++ W ++ FR+RIA Sbjct: 573 FPEGPAQISALMRRPKQSNHTDCGIFVMKYMDYMLQGFH-LQSMSWTSSDVETFRYRIAK 631 Query: 181 ELRMCKARDIP 149 E++ KAR IP Sbjct: 632 EIQRGKARMIP 642 >XP_017217910.1 PREDICTED: ubiquitin-like-specific protease 1A [Daucus carota subsp. sativus] Length = 281 Score = 57.4 bits (137), Expect = 3e-07 Identities = 31/80 (38%), Positives = 43/80 (53%) Frame = -3 Query: 388 LRQANPTAKWPKSKPKVEACVNRPRQ*NEDDCGIYVAKYVDFFLHRINIMEEPRWILNEA 209 LR P PK P V+ P+Q N DCG+Y+ KY+D+ L + + W ++ Sbjct: 191 LRYLGPRLTVPKEDPLVQVWDAMPKQNNYTDCGVYICKYMDYLLQGYD-LSTLVWDASDL 249 Query: 208 YNFRFRIAHELRMCKARDIP 149 FR+RIA EL+ KAR IP Sbjct: 250 EVFRYRIAKELQKGKARSIP 269 >XP_017257223.1 PREDICTED: ubiquitin-like-specific protease 1A [Daucus carota subsp. sativus] Length = 281 Score = 57.4 bits (137), Expect = 3e-07 Identities = 31/80 (38%), Positives = 43/80 (53%) Frame = -3 Query: 388 LRQANPTAKWPKSKPKVEACVNRPRQ*NEDDCGIYVAKYVDFFLHRINIMEEPRWILNEA 209 LR P PK P V+ P+Q N DCG+Y+ KY+D+ L + + W ++ Sbjct: 191 LRYLGPRLTVPKEDPLVQVWDAMPKQNNYTDCGVYICKYMDYLLQGYD-LSTLVWDASDL 249 Query: 208 YNFRFRIAHELRMCKARDIP 149 FR+RIA EL+ KAR IP Sbjct: 250 EVFRYRIAKELQKGKARSIP 269 >XP_017239691.1 PREDICTED: uncharacterized protein LOC108212478 [Daucus carota subsp. sativus] Length = 913 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/80 (38%), Positives = 43/80 (53%) Frame = -3 Query: 388 LRQANPTAKWPKSKPKVEACVNRPRQ*NEDDCGIYVAKYVDFFLHRINIMEEPRWILNEA 209 LR P PK P V+ P+Q N DCG+Y+ KY+D+ L + + W ++ Sbjct: 823 LRYLGPRLTVPKEDPLVQVWDAMPKQNNYTDCGVYICKYMDYLLQGYD-LSTLLWDASDL 881 Query: 208 YNFRFRIAHELRMCKARDIP 149 FR+RIA EL+ KAR IP Sbjct: 882 EVFRYRIAKELQKGKARSIP 901 >XP_017239388.1 PREDICTED: ubiquitin-like-specific protease 1A [Daucus carota subsp. sativus] Length = 348 Score = 57.4 bits (137), Expect = 4e-07 Identities = 31/80 (38%), Positives = 43/80 (53%) Frame = -3 Query: 388 LRQANPTAKWPKSKPKVEACVNRPRQ*NEDDCGIYVAKYVDFFLHRINIMEEPRWILNEA 209 LR P PK P V+ P+Q N DCG+Y+ KY+D+ L + + W ++ Sbjct: 258 LRYLGPRLTVPKEDPLVQVWDAMPKQNNYTDCGVYICKYMDYLLQGYD-LSTLVWDASDL 316 Query: 208 YNFRFRIAHELRMCKARDIP 149 FR+RIA EL+ KAR IP Sbjct: 317 EVFRYRIAKELQKGKARSIP 336 >XP_017217396.1 PREDICTED: uncharacterized protein LOC108194972 [Daucus carota subsp. sativus] Length = 450 Score = 57.4 bits (137), Expect = 4e-07 Identities = 31/80 (38%), Positives = 43/80 (53%) Frame = -3 Query: 388 LRQANPTAKWPKSKPKVEACVNRPRQ*NEDDCGIYVAKYVDFFLHRINIMEEPRWILNEA 209 LR P PK P V+ P+Q N DCG+Y+ KY+D+ L + + W ++ Sbjct: 360 LRYLGPRLTVPKEDPLVQVWDAMPKQNNYTDCGVYICKYMDYLLQGYD-LSTLVWDASDL 418 Query: 208 YNFRFRIAHELRMCKARDIP 149 FR+RIA EL+ KAR IP Sbjct: 419 EVFRYRIAKELQKGKARSIP 438 >XP_017246770.1 PREDICTED: putative ubiquitin-like-specific protease 1B [Daucus carota subsp. sativus] Length = 128 Score = 53.5 bits (127), Expect = 2e-06 Identities = 28/72 (38%), Positives = 41/72 (56%) Frame = -3 Query: 364 KWPKSKPKVEACVNRPRQ*NEDDCGIYVAKYVDFFLHRINIMEEPRWILNEAYNFRFRIA 185 K+PK P V P+Q N DCG++V KY+D+ L + + W ++ FR+RIA Sbjct: 45 KFPKEDPLVHVWDEMPKQQNHFDCGVFVCKYMDYTLQGYD-LSTLTWDTSDVDLFRYRIA 103 Query: 184 HELRMCKARDIP 149 EL+ +AR IP Sbjct: 104 KELQKGRARRIP 115 >KZM80533.1 hypothetical protein DCAR_032179 [Daucus carota subsp. sativus] Length = 466 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/71 (36%), Positives = 41/71 (57%) Frame = -3 Query: 361 WPKSKPKVEACVNRPRQ*NEDDCGIYVAKYVDFFLHRINIMEEPRWILNEAYNFRFRIAH 182 +P ++ A + RP+Q N DC I+V KY+D+ L + ++ W ++ FR+RIA Sbjct: 380 FPDGLAQISALMRRPKQTNYTDCSIFVMKYMDYMLQGFH-LQSMTWTASDVETFRYRIAK 438 Query: 181 ELRMCKARDIP 149 E+ KAR IP Sbjct: 439 EIHRGKARMIP 449 >XP_017222790.1 PREDICTED: putative ubiquitin-like-specific protease 1B [Daucus carota subsp. sativus] Length = 128 Score = 52.0 bits (123), Expect = 6e-06 Identities = 27/72 (37%), Positives = 41/72 (56%) Frame = -3 Query: 364 KWPKSKPKVEACVNRPRQ*NEDDCGIYVAKYVDFFLHRINIMEEPRWILNEAYNFRFRIA 185 K+P+ P V P+Q N DCG++V KY+D+ L + + W ++ FR+RIA Sbjct: 45 KFPQEDPLVHVWDEMPKQQNHFDCGVFVCKYMDYTLQGYD-LSTLTWDTSDVDLFRYRIA 103 Query: 184 HELRMCKARDIP 149 EL+ +AR IP Sbjct: 104 KELQKGRARRIP 115