BLASTX nr result
ID: Panax25_contig00025282
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00025282 (711 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016184443.1 PREDICTED: TBC1 domain family member 9-like [Arac... 84 1e-17 KOM46351.1 hypothetical protein LR48_Vigan07g005500 [Vigna angul... 86 1e-15 XP_019435763.1 PREDICTED: TBC1 domain family member 2A-like [Lup... 81 4e-14 XP_016166518.1 PREDICTED: TBC1 domain family member 2A [Arachis ... 81 4e-14 XP_015972709.1 PREDICTED: TBC1 domain family member 2A [Arachis ... 81 4e-14 XP_015871988.1 PREDICTED: TBC1 domain family member 2A [Ziziphus... 79 4e-14 XP_019159274.1 PREDICTED: growth hormone-regulated TBC protein 1... 81 4e-14 XP_019159273.1 PREDICTED: growth hormone-regulated TBC protein 1... 81 4e-14 KVI10640.1 Rab-GTPase-TBC domain-containing protein [Cynara card... 80 6e-14 XP_017249137.1 PREDICTED: TBC1 domain family member 2B-like [Dau... 80 6e-14 KRH74044.1 hypothetical protein GLYMA_02G308000 [Glycine max] 79 8e-14 XP_016901858.1 PREDICTED: small G protein signaling modulator 3 ... 80 1e-13 XP_006357988.1 PREDICTED: TBC1 domain family member 2B-like [Sol... 80 1e-13 XP_004243501.1 PREDICTED: growth hormone-regulated TBC protein 1... 80 1e-13 XP_019457021.1 PREDICTED: TBC1 domain family member 2A-like [Lup... 80 1e-13 XP_016580596.1 PREDICTED: growth hormone-regulated TBC protein 1... 80 1e-13 KJB10725.1 hypothetical protein B456_001G218800 [Gossypium raimo... 79 1e-13 XP_010547231.1 PREDICTED: growth hormone-regulated TBC protein 1... 80 1e-13 XP_009785668.1 PREDICTED: TBC1 domain family member 2A-like [Nic... 79 1e-13 XP_019247004.1 PREDICTED: TBC1 domain family member 2B-like [Nic... 79 1e-13 >XP_016184443.1 PREDICTED: TBC1 domain family member 9-like [Arachis ipaensis] XP_016184444.1 PREDICTED: TBC1 domain family member 9-like [Arachis ipaensis] Length = 78 Score = 84.0 bits (206), Expect = 1e-17 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +1 Query: 559 QDLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQVIII 690 QDLP+TFPGHPWLDT EG+AALRRVLVVYS CDS+VGYCQV +I Sbjct: 29 QDLPQTFPGHPWLDTLEGHAALRRVLVVYSLCDSNVGYCQVDLI 72 >KOM46351.1 hypothetical protein LR48_Vigan07g005500 [Vigna angularis] Length = 443 Score = 85.5 bits (210), Expect = 1e-15 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +1 Query: 553 CIQDLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 C+QDLPRTFPGHPWLDT EG+AALRRVLV YSF DSDVGYCQ Sbjct: 207 CLQDLPRTFPGHPWLDTPEGHAALRRVLVAYSFRDSDVGYCQ 248 >XP_019435763.1 PREDICTED: TBC1 domain family member 2A-like [Lupinus angustifolius] OIW16444.1 hypothetical protein TanjilG_19160 [Lupinus angustifolius] Length = 395 Score = 80.9 bits (198), Expect = 4e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 DLPRTFPGHPWLDT EG+AALRRVLVVYSF DSDVGYCQ Sbjct: 162 DLPRTFPGHPWLDTPEGHAALRRVLVVYSFRDSDVGYCQ 200 >XP_016166518.1 PREDICTED: TBC1 domain family member 2A [Arachis ipaensis] Length = 395 Score = 80.9 bits (198), Expect = 4e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 DLPRTFPGHPWLDT EG+AALRRVLVVYSF DSDVGYCQ Sbjct: 162 DLPRTFPGHPWLDTPEGHAALRRVLVVYSFRDSDVGYCQ 200 >XP_015972709.1 PREDICTED: TBC1 domain family member 2A [Arachis duranensis] Length = 395 Score = 80.9 bits (198), Expect = 4e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 DLPRTFPGHPWLDT EG+AALRRVLVVYSF DSDVGYCQ Sbjct: 162 DLPRTFPGHPWLDTPEGHAALRRVLVVYSFRDSDVGYCQ 200 >XP_015871988.1 PREDICTED: TBC1 domain family member 2A [Ziziphus jujuba] Length = 238 Score = 79.0 bits (193), Expect = 4e-14 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +1 Query: 556 IQDLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 +QDLPRTFPGHPWLDT EG+A LRRVLV YSF DSDVGYCQ Sbjct: 1 MQDLPRTFPGHPWLDTPEGHATLRRVLVGYSFRDSDVGYCQ 41 >XP_019159274.1 PREDICTED: growth hormone-regulated TBC protein 1-like isoform X2 [Ipomoea nil] XP_019159275.1 PREDICTED: growth hormone-regulated TBC protein 1-like isoform X2 [Ipomoea nil] Length = 397 Score = 80.9 bits (198), Expect = 4e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 DLPRTFPGHPWLDT EG+AALRRVLVVYSF DSDVGYCQ Sbjct: 164 DLPRTFPGHPWLDTPEGHAALRRVLVVYSFRDSDVGYCQ 202 >XP_019159273.1 PREDICTED: growth hormone-regulated TBC protein 1-like isoform X1 [Ipomoea nil] Length = 408 Score = 80.9 bits (198), Expect = 4e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 DLPRTFPGHPWLDT EG+AALRRVLVVYSF DSDVGYCQ Sbjct: 175 DLPRTFPGHPWLDTPEGHAALRRVLVVYSFRDSDVGYCQ 213 >KVI10640.1 Rab-GTPase-TBC domain-containing protein [Cynara cardunculus var. scolymus] Length = 309 Score = 79.7 bits (195), Expect = 6e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 DLPRTFPGHPWLDT +G+AALRRVLVVYSF DSDVGYCQ Sbjct: 160 DLPRTFPGHPWLDTPDGHAALRRVLVVYSFRDSDVGYCQ 198 >XP_017249137.1 PREDICTED: TBC1 domain family member 2B-like [Daucus carota subsp. sativus] KZM96481.1 hypothetical protein DCAR_019723 [Daucus carota subsp. sativus] Length = 396 Score = 80.5 bits (197), Expect = 6e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 DLPRTFPGHPWLDTKEG+AALRRVLV YSF DSDVGYCQ Sbjct: 159 DLPRTFPGHPWLDTKEGHAALRRVLVGYSFRDSDVGYCQ 197 >KRH74044.1 hypothetical protein GLYMA_02G308000 [Glycine max] Length = 316 Score = 79.3 bits (194), Expect = 8e-14 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 DLPRTFPGHPWLDT EG+AALRRVLV YSF DSDVGYCQ Sbjct: 162 DLPRTFPGHPWLDTPEGHAALRRVLVAYSFRDSDVGYCQ 200 >XP_016901858.1 PREDICTED: small G protein signaling modulator 3 [Cucumis melo] Length = 393 Score = 79.7 bits (195), Expect = 1e-13 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQV 681 DLPRTFPGHPWLDT EG+AALRRVLV YSF DSDVGYCQV Sbjct: 162 DLPRTFPGHPWLDTPEGHAALRRVLVGYSFRDSDVGYCQV 201 >XP_006357988.1 PREDICTED: TBC1 domain family member 2B-like [Solanum tuberosum] Length = 394 Score = 79.7 bits (195), Expect = 1e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 DLPRTFPGHPWLDT EG+AALRRVLV YSF DSDVGYCQ Sbjct: 160 DLPRTFPGHPWLDTSEGHAALRRVLVAYSFRDSDVGYCQ 198 >XP_004243501.1 PREDICTED: growth hormone-regulated TBC protein 1-like [Solanum lycopersicum] XP_015080587.1 PREDICTED: growth hormone-regulated TBC protein 1-like [Solanum pennellii] Length = 394 Score = 79.7 bits (195), Expect = 1e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 DLPRTFPGHPWLDT EG+AALRRVLV YSF DSDVGYCQ Sbjct: 160 DLPRTFPGHPWLDTSEGHAALRRVLVAYSFRDSDVGYCQ 198 >XP_019457021.1 PREDICTED: TBC1 domain family member 2A-like [Lupinus angustifolius] OIW04287.1 hypothetical protein TanjilG_00847 [Lupinus angustifolius] Length = 395 Score = 79.7 bits (195), Expect = 1e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 DLPRTFPGHPWLDT EG+A+LRRVLVVYSF DSDVGYCQ Sbjct: 162 DLPRTFPGHPWLDTPEGHASLRRVLVVYSFRDSDVGYCQ 200 >XP_016580596.1 PREDICTED: growth hormone-regulated TBC protein 1-like [Capsicum annuum] Length = 395 Score = 79.7 bits (195), Expect = 1e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 DLPRTFPGHPWLDT EG+AALRRVLV YSF DSDVGYCQ Sbjct: 161 DLPRTFPGHPWLDTSEGHAALRRVLVAYSFRDSDVGYCQ 199 >KJB10725.1 hypothetical protein B456_001G218800 [Gossypium raimondii] Length = 281 Score = 78.6 bits (192), Expect = 1e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQV 681 DLPRTFPGHPWLDT EG+AALRRVLV YSF DSDVGYCQ+ Sbjct: 165 DLPRTFPGHPWLDTPEGHAALRRVLVGYSFRDSDVGYCQM 204 >XP_010547231.1 PREDICTED: growth hormone-regulated TBC protein 1-A-like [Tarenaya hassleriana] XP_010547232.1 PREDICTED: growth hormone-regulated TBC protein 1-A-like [Tarenaya hassleriana] Length = 398 Score = 79.7 bits (195), Expect = 1e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 DLPRTFPGHPWLDT EG+A+LRRVLVVYSF DSDVGYCQ Sbjct: 165 DLPRTFPGHPWLDTPEGHASLRRVLVVYSFRDSDVGYCQ 203 >XP_009785668.1 PREDICTED: TBC1 domain family member 2A-like [Nicotiana sylvestris] XP_016442339.1 PREDICTED: TBC1 domain family member 2A-like [Nicotiana tabacum] Length = 392 Score = 79.3 bits (194), Expect = 1e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 DLPRTFPGHPWLDT EG+AALRRVLV YSF DSDVGYCQ Sbjct: 160 DLPRTFPGHPWLDTPEGHAALRRVLVAYSFRDSDVGYCQ 198 >XP_019247004.1 PREDICTED: TBC1 domain family member 2B-like [Nicotiana attenuata] OIT01765.1 hypothetical protein A4A49_16859 [Nicotiana attenuata] Length = 394 Score = 79.3 bits (194), Expect = 1e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +1 Query: 562 DLPRTFPGHPWLDTKEGYAALRRVLVVYSFCDSDVGYCQ 678 DLPRTFPGHPWLDT EG+AALRRVLV YSF DSDVGYCQ Sbjct: 160 DLPRTFPGHPWLDTPEGHAALRRVLVAYSFRDSDVGYCQ 198