BLASTX nr result
ID: Panax25_contig00025268
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00025268 (396 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO55045.1 hypothetical protein CISIN_1g029223mg [Citrus sinensis] 62 8e-10 XP_012476634.1 PREDICTED: putative H/ACA ribonucleoprotein compl... 63 1e-09 KDO55044.1 hypothetical protein CISIN_1g029223mg [Citrus sinensis] 62 1e-09 KDO55043.1 hypothetical protein CISIN_1g029223mg [Citrus sinensis] 62 1e-09 KDO55042.1 hypothetical protein CISIN_1g029223mg [Citrus sinensis] 62 1e-09 ERM93526.1 hypothetical protein AMTR_s00004p00060080 [Amborella ... 62 1e-09 ACG27024.1 h/ACA ribonucleoprotein complex subunit 1-like protei... 63 2e-09 NP_001132376.1 uncharacterized protein LOC100193822 [Zea mays] A... 63 2e-09 XP_020100318.1 putative H/ACA ribonucleoprotein complex subunit ... 62 2e-09 XP_006663547.1 PREDICTED: putative H/ACA ribonucleoprotein compl... 62 2e-09 XP_003548749.1 PREDICTED: putative H/ACA ribonucleoprotein compl... 62 2e-09 XP_016454805.1 PREDICTED: putative H/ACA ribonucleoprotein compl... 62 3e-09 XP_009599775.1 PREDICTED: putative H/ACA ribonucleoprotein compl... 62 3e-09 XP_010909944.1 PREDICTED: putative H/ACA ribonucleoprotein compl... 62 3e-09 XP_019266943.1 PREDICTED: putative H/ACA ribonucleoprotein compl... 62 3e-09 XP_010909943.1 PREDICTED: putative H/ACA ribonucleoprotein compl... 62 3e-09 XP_009800302.1 PREDICTED: putative H/ACA ribonucleoprotein compl... 62 3e-09 XP_012434715.1 PREDICTED: putative H/ACA ribonucleoprotein compl... 62 3e-09 XP_011622168.1 PREDICTED: putative H/ACA ribonucleoprotein compl... 62 3e-09 XP_006479107.1 PREDICTED: putative H/ACA ribonucleoprotein compl... 62 3e-09 >KDO55045.1 hypothetical protein CISIN_1g029223mg [Citrus sinensis] Length = 120 Score = 62.0 bits (149), Expect = 8e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 + DEGPPAEVVEVS+F+H CEGDAVTKLTNEK Sbjct: 41 FRDEGPPAEVVEVSSFLHACEGDAVTKLTNEK 72 >XP_012476634.1 PREDICTED: putative H/ACA ribonucleoprotein complex subunit 1-like protein 1 [Gossypium raimondii] KJB26491.1 hypothetical protein B456_004G244500 [Gossypium raimondii] Length = 193 Score = 63.2 bits (152), Expect = 1e-09 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 4/39 (10%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK----NAN 258 + DEGPPAEVVEVS FVH CEGDAVTKLTNEK NAN Sbjct: 38 FRDEGPPAEVVEVSTFVHACEGDAVTKLTNEKIPYFNAN 76 >KDO55044.1 hypothetical protein CISIN_1g029223mg [Citrus sinensis] Length = 140 Score = 62.0 bits (149), Expect = 1e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 + DEGPPAEVVEVS+F+H CEGDAVTKLTNEK Sbjct: 41 FRDEGPPAEVVEVSSFLHACEGDAVTKLTNEK 72 >KDO55043.1 hypothetical protein CISIN_1g029223mg [Citrus sinensis] Length = 147 Score = 62.0 bits (149), Expect = 1e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 + DEGPPAEVVEVS+F+H CEGDAVTKLTNEK Sbjct: 41 FRDEGPPAEVVEVSSFLHACEGDAVTKLTNEK 72 >KDO55042.1 hypothetical protein CISIN_1g029223mg [Citrus sinensis] Length = 147 Score = 62.0 bits (149), Expect = 1e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 + DEGPPAEVVEVS+F+H CEGDAVTKLTNEK Sbjct: 41 FRDEGPPAEVVEVSSFLHACEGDAVTKLTNEK 72 >ERM93526.1 hypothetical protein AMTR_s00004p00060080 [Amborella trichopoda] Length = 149 Score = 62.0 bits (149), Expect = 1e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 + DEGPPAEVVEVS+F+H CEGDAVTKLTNEK Sbjct: 42 FRDEGPPAEVVEVSSFLHACEGDAVTKLTNEK 73 >ACG27024.1 h/ACA ribonucleoprotein complex subunit 1-like protein 1 [Zea mays] Length = 191 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 + DEGPPAEVVEVS FVH CEGDAVTKLTNEK Sbjct: 39 FRDEGPPAEVVEVSTFVHACEGDAVTKLTNEK 70 >NP_001132376.1 uncharacterized protein LOC100193822 [Zea mays] ACF81193.1 unknown [Zea mays] ONM27018.1 Putative H/ACA ribonucleoprotein complex subunit 1-like protein 1 [Zea mays] Length = 191 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 + DEGPPAEVVEVS FVH CEGDAVTKLTNEK Sbjct: 39 FRDEGPPAEVVEVSTFVHACEGDAVTKLTNEK 70 >XP_020100318.1 putative H/ACA ribonucleoprotein complex subunit 1-like protein 1 [Ananas comosus] Length = 163 Score = 62.0 bits (149), Expect = 2e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 + DEGPPAEVVEVS+F+H CEGDAVTKLTNEK Sbjct: 38 FRDEGPPAEVVEVSSFLHACEGDAVTKLTNEK 69 >XP_006663547.1 PREDICTED: putative H/ACA ribonucleoprotein complex subunit 1-like protein 1, partial [Oryza brachyantha] Length = 154 Score = 61.6 bits (148), Expect = 2e-09 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 + DEGPPAEVVEVS F+H CEGDAVTKLTNEK Sbjct: 3 FRDEGPPAEVVEVSTFLHACEGDAVTKLTNEK 34 >XP_003548749.1 PREDICTED: putative H/ACA ribonucleoprotein complex subunit 1-like protein 1 [Glycine max] KRH06715.1 hypothetical protein GLYMA_16G041400 [Glycine max] Length = 195 Score = 62.4 bits (150), Expect = 2e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 Y DEGPP+EVVEVS+F+H CEGDAVTKLTNEK Sbjct: 42 YRDEGPPSEVVEVSSFMHACEGDAVTKLTNEK 73 >XP_016454805.1 PREDICTED: putative H/ACA ribonucleoprotein complex subunit 1-like protein 1 [Nicotiana tabacum] Length = 185 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 356 DEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 DEGPP+EVVEVSAFVH CEGDAVTKLTNEK Sbjct: 37 DEGPPSEVVEVSAFVHACEGDAVTKLTNEK 66 >XP_009599775.1 PREDICTED: putative H/ACA ribonucleoprotein complex subunit 1-like protein 1 [Nicotiana tomentosiformis] XP_016436854.1 PREDICTED: putative H/ACA ribonucleoprotein complex subunit 1-like protein 1 [Nicotiana tabacum] Length = 185 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 356 DEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 DEGPP+EVVEVSAFVH CEGDAVTKLTNEK Sbjct: 37 DEGPPSEVVEVSAFVHACEGDAVTKLTNEK 66 >XP_010909944.1 PREDICTED: putative H/ACA ribonucleoprotein complex subunit 1-like protein 1 isoform X2 [Elaeis guineensis] Length = 187 Score = 62.0 bits (149), Expect = 3e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 + DEGPPAEVVEVS+F+H CEGDAVTKLTNEK Sbjct: 34 FRDEGPPAEVVEVSSFLHSCEGDAVTKLTNEK 65 >XP_019266943.1 PREDICTED: putative H/ACA ribonucleoprotein complex subunit 1-like protein 1 [Nicotiana attenuata] OIT34713.1 putative haca ribonucleoprotein complex subunit 1-like protein 1 [Nicotiana attenuata] Length = 188 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 356 DEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 DEGPP+EVVEVSAFVH CEGDAVTKLTNEK Sbjct: 37 DEGPPSEVVEVSAFVHACEGDAVTKLTNEK 66 >XP_010909943.1 PREDICTED: putative H/ACA ribonucleoprotein complex subunit 1-like protein 1 isoform X1 [Elaeis guineensis] Length = 188 Score = 62.0 bits (149), Expect = 3e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 + DEGPPAEVVEVS+F+H CEGDAVTKLTNEK Sbjct: 34 FRDEGPPAEVVEVSSFLHSCEGDAVTKLTNEK 65 >XP_009800302.1 PREDICTED: putative H/ACA ribonucleoprotein complex subunit 1-like protein 1 [Nicotiana sylvestris] Length = 188 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 356 DEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 DEGPP+EVVEVSAFVH CEGDAVTKLTNEK Sbjct: 37 DEGPPSEVVEVSAFVHACEGDAVTKLTNEK 66 >XP_012434715.1 PREDICTED: putative H/ACA ribonucleoprotein complex subunit 1-like protein 1 [Gossypium raimondii] KJB45949.1 hypothetical protein B456_007G343400 [Gossypium raimondii] Length = 194 Score = 62.0 bits (149), Expect = 3e-09 Identities = 30/39 (76%), Positives = 32/39 (82%), Gaps = 4/39 (10%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK----NAN 258 + DEGPPAEVVEVS F+H CEGDAVTKLTNEK NAN Sbjct: 38 FRDEGPPAEVVEVSTFLHACEGDAVTKLTNEKIPFFNAN 76 >XP_011622168.1 PREDICTED: putative H/ACA ribonucleoprotein complex subunit 1-like protein 1 [Amborella trichopoda] Length = 195 Score = 62.0 bits (149), Expect = 3e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 + DEGPPAEVVEVS+F+H CEGDAVTKLTNEK Sbjct: 42 FRDEGPPAEVVEVSSFLHACEGDAVTKLTNEK 73 >XP_006479107.1 PREDICTED: putative H/ACA ribonucleoprotein complex subunit 1-like protein 1 [Citrus sinensis] KDO55041.1 hypothetical protein CISIN_1g029223mg [Citrus sinensis] Length = 197 Score = 62.0 bits (149), Expect = 3e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 362 YHDEGPPAEVVEVSAFVHGCEGDAVTKLTNEK 267 + DEGPPAEVVEVS+F+H CEGDAVTKLTNEK Sbjct: 41 FRDEGPPAEVVEVSSFLHACEGDAVTKLTNEK 72