BLASTX nr result
ID: Panax25_contig00025193
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00025193 (587 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVI05065.1 hypothetical protein Ccrd_016620 [Cynara cardunculus ... 68 2e-11 CDO99827.1 unnamed protein product [Coffea canephora] 65 3e-10 KVI06853.1 hypothetical protein Ccrd_014791 [Cynara cardunculus ... 64 5e-10 OMO87242.1 hypothetical protein CCACVL1_09170 [Corchorus capsula... 63 2e-09 OAY45809.1 hypothetical protein MANES_07G093500 [Manihot esculenta] 62 2e-09 GAV90640.1 hypothetical protein CFOL_v3_34047 [Cephalotus follic... 62 5e-09 OMO62837.1 hypothetical protein COLO4_32872 [Corchorus olitorius] 62 6e-09 KZM95817.1 hypothetical protein DCAR_019059 [Daucus carota subsp... 60 1e-08 XP_006379504.1 hypothetical protein POPTR_0008s02960g [Populus t... 60 1e-08 XP_011469403.1 PREDICTED: cyclin-dependent protein kinase inhibi... 60 1e-08 XP_015876638.1 PREDICTED: cyclin-dependent protein kinase inhibi... 60 2e-08 XP_010106827.1 hypothetical protein L484_001720 [Morus notabilis... 60 2e-08 XP_009764348.1 PREDICTED: cyclin-dependent protein kinase inhibi... 59 4e-08 XP_012834511.1 PREDICTED: cyclin-dependent protein kinase inhibi... 58 8e-08 EYU39688.1 hypothetical protein MIMGU_mgv1a020647mg [Erythranthe... 58 9e-08 XP_008232059.1 PREDICTED: cyclin-dependent protein kinase inhibi... 58 1e-07 XP_007218625.1 hypothetical protein PRUPE_ppa013617mg [Prunus pe... 58 1e-07 OAY38921.1 hypothetical protein MANES_10G053200 [Manihot esculenta] 58 1e-07 XP_018848069.1 PREDICTED: cyclin-dependent protein kinase inhibi... 57 2e-07 KCW87448.1 hypothetical protein EUGRSUZ_B03916 [Eucalyptus grandis] 57 3e-07 >KVI05065.1 hypothetical protein Ccrd_016620 [Cynara cardunculus var. scolymus] Length = 117 Score = 67.8 bits (164), Expect = 2e-11 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAAVSCKRKL---EFFEIVGREEIESFFR-SFCCKGNISMKKRRQ 420 IP ILSCPPPP+KQR +A SCKR+L +FFE+V REEI+SFF+ S+ S KKRR+ Sbjct: 56 IPEILSCPPPPKKQRHSAPSCKRRLCEFQFFEVVAREEIDSFFKSSYEFINQESSKKRRR 115 >CDO99827.1 unnamed protein product [Coffea canephora] Length = 126 Score = 65.1 bits (157), Expect = 3e-10 Identities = 34/43 (79%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = -1 Query: 587 IPAILSCPPPPRKQ-RPAAVSCKRKL-EFFEIVGREEIESFFR 465 IP ILSCPP P+K RPA+ SCKRKL EFFE VGREEIESFFR Sbjct: 66 IPEILSCPPAPKKPTRPASSSCKRKLSEFFEFVGREEIESFFR 108 >KVI06853.1 hypothetical protein Ccrd_014791 [Cynara cardunculus var. scolymus] Length = 123 Score = 64.3 bits (155), Expect = 5e-10 Identities = 32/61 (52%), Positives = 45/61 (73%), Gaps = 6/61 (9%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAAVSCKRKL---EFFEIVGREEIESFFRS---FCCKGNISMKKR 426 IP I++CPPPP+KQR + SCKR++ +FFEIV R+E+ESFFRS F + + + K+R Sbjct: 60 IPQIITCPPPPKKQRISGPSCKRRISEFQFFEIVARDEVESFFRSSYEFINQNSNTNKRR 119 Query: 425 R 423 R Sbjct: 120 R 120 >OMO87242.1 hypothetical protein CCACVL1_09170 [Corchorus capsularis] Length = 127 Score = 62.8 bits (151), Expect = 2e-09 Identities = 34/62 (54%), Positives = 41/62 (66%), Gaps = 4/62 (6%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAAVSCKRKL----EFFEIVGREEIESFFRSFCCKGNISMKKRRQ 420 IPA+LSCPP PRK + VSCKRKL +FFEIV REE++ FFR+ + S KRR Sbjct: 67 IPAVLSCPPAPRKPKRKPVSCKRKLSDQFDFFEIVNREEVDEFFRA--AGFDDSFNKRRC 124 Query: 419 VC 414 C Sbjct: 125 PC 126 >OAY45809.1 hypothetical protein MANES_07G093500 [Manihot esculenta] Length = 114 Score = 62.4 bits (150), Expect = 2e-09 Identities = 31/45 (68%), Positives = 34/45 (75%), Gaps = 3/45 (6%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAAVSCKRKL---EFFEIVGREEIESFFRS 462 IP ILSCPP P+K R SCKRKL EFFEIV R+E+ESFFRS Sbjct: 56 IPTILSCPPAPQKPRRRMFSCKRKLSEFEFFEIVNRQEVESFFRS 100 >GAV90640.1 hypothetical protein CFOL_v3_34047 [Cephalotus follicularis] Length = 118 Score = 61.6 bits (148), Expect = 5e-09 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAAVSCKRKLEFFEIVGREEIESFFRS 462 IPA+L CPP PRK RP SCKR+L+FFEIV EEI++FFRS Sbjct: 64 IPALLFCPPAPRKPRPT-FSCKRRLQFFEIVNPEEIDNFFRS 104 >OMO62837.1 hypothetical protein COLO4_32872 [Corchorus olitorius] Length = 127 Score = 61.6 bits (148), Expect = 6e-09 Identities = 34/62 (54%), Positives = 40/62 (64%), Gaps = 4/62 (6%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAAVSCKRKL----EFFEIVGREEIESFFRSFCCKGNISMKKRRQ 420 IP ILSCPP PRK + VSCKRKL +FFEIV REE++ FFR+ + S KRR Sbjct: 67 IPEILSCPPAPRKPKRKPVSCKRKLSDQFDFFEIVNREEVDEFFRA--AAFDDSFNKRRC 124 Query: 419 VC 414 C Sbjct: 125 PC 126 >KZM95817.1 hypothetical protein DCAR_019059 [Daucus carota subsp. sativus] Length = 96 Score = 60.1 bits (144), Expect = 1e-08 Identities = 29/42 (69%), Positives = 33/42 (78%), Gaps = 2/42 (4%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAA--VSCKRKLEFFEIVGREEIESFF 468 IPAILSCPP PRK+R V+CKRKLEFFE++ EEIE FF Sbjct: 37 IPAILSCPPAPRKRRAVLRPVACKRKLEFFEVIHFEEIEEFF 78 >XP_006379504.1 hypothetical protein POPTR_0008s02960g [Populus trichocarpa] ERP57301.1 hypothetical protein POPTR_0008s02960g [Populus trichocarpa] Length = 113 Score = 60.5 bits (145), Expect = 1e-08 Identities = 31/45 (68%), Positives = 36/45 (80%), Gaps = 3/45 (6%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAAVSCKRKL---EFFEIVGREEIESFFRS 462 IPA+LSCPP PRK R + SCKRKL EFFEIV REE++SFF+S Sbjct: 57 IPAVLSCPPAPRKPR-RSFSCKRKLTELEFFEIVNREEVDSFFQS 100 >XP_011469403.1 PREDICTED: cyclin-dependent protein kinase inhibitor SMR2-like [Fragaria vesca subsp. vesca] Length = 116 Score = 60.5 bits (145), Expect = 1e-08 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 3/45 (6%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAAVSCKRK---LEFFEIVGREEIESFFRS 462 IPA+++CPP PRK R AA SCKRK L+FFE+V R+E+E+FF S Sbjct: 60 IPAVVTCPPAPRKPRRAAGSCKRKLTELQFFEVVNRDEVEAFFGS 104 >XP_015876638.1 PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like isoform X1 [Ziziphus jujuba] XP_015876639.1 PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like isoform X2 [Ziziphus jujuba] Length = 130 Score = 60.5 bits (145), Expect = 2e-08 Identities = 32/62 (51%), Positives = 40/62 (64%), Gaps = 4/62 (6%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAAVSCKRK---LEFFEIVGREEIESFFR-SFCCKGNISMKKRRQ 420 IP +L+CPP PRK + AV CKRK L+FFEIV R+E++SFFR SF G +R Sbjct: 66 IPELLTCPPAPRKPKTRAVQCKRKLTELKFFEIVKRDEVDSFFRSSFEVSGINGSSAKRS 125 Query: 419 VC 414 C Sbjct: 126 CC 127 >XP_010106827.1 hypothetical protein L484_001720 [Morus notabilis] EXC11979.1 hypothetical protein L484_001720 [Morus notabilis] Length = 142 Score = 60.5 bits (145), Expect = 2e-08 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 4/58 (6%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPA-AVSCKRKL---EFFEIVGREEIESFFRSFCCKGNISMKKR 426 IPAILSCPP PRK A A SCKRKL +FF++V REEI+ FFRS K KR Sbjct: 79 IPAILSCPPAPRKPATARAPSCKRKLSELDFFDVVNREEIDRFFRSSFAKAATGSAKR 136 >XP_009764348.1 PREDICTED: cyclin-dependent protein kinase inhibitor SMR1 [Nicotiana sylvestris] Length = 107 Score = 58.9 bits (141), Expect = 4e-08 Identities = 32/56 (57%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAAVSCKRK-LEFFEIVGREEIESFFRSFCCKGNISMKKRR 423 IP ILSCPP P+K + + SCKRK L+FFEIV R+EI+SFF+ N KKRR Sbjct: 50 IPKILSCPPAPKKPKRVS-SCKRKLLDFFEIVKRDEIDSFFKLVDVNSNGDTKKRR 104 >XP_012834511.1 PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like [Erythranthe guttata] Length = 106 Score = 58.2 bits (139), Expect = 8e-08 Identities = 31/62 (50%), Positives = 42/62 (67%), Gaps = 3/62 (4%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAAVSCKRK---LEFFEIVGREEIESFFRSFCCKGNISMKKRRQV 417 IP +SCPP P+K+RPAA +CKRK L+FFE VGREEIES F + N + + ++ Sbjct: 47 IPTAVSCPPAPKKRRPAA-ACKRKLCELQFFEFVGREEIESLFE--IAQVNFNNRSTKRN 103 Query: 416 CM 411 C+ Sbjct: 104 CL 105 >EYU39688.1 hypothetical protein MIMGU_mgv1a020647mg [Erythranthe guttata] Length = 100 Score = 57.8 bits (138), Expect = 9e-08 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 3/43 (6%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAAVSCKRK---LEFFEIVGREEIESFF 468 IP +SCPP P+K+RPAA +CKRK L+FFE VGREEIES F Sbjct: 47 IPTAVSCPPAPKKRRPAA-ACKRKLCELQFFEFVGREEIESLF 88 >XP_008232059.1 PREDICTED: cyclin-dependent protein kinase inhibitor SMR3 [Prunus mume] Length = 112 Score = 57.8 bits (138), Expect = 1e-07 Identities = 26/43 (60%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -1 Query: 587 IPAILSCPPPPRKQ-RPAAVSCKRKLEFFEIVGREEIESFFRS 462 IP +++CPP PRK R AA SCKRKL+FFE ++E+E FFRS Sbjct: 55 IPTVVTCPPAPRKPARRAASSCKRKLQFFETANQDEVEDFFRS 97 >XP_007218625.1 hypothetical protein PRUPE_ppa013617mg [Prunus persica] ONI21869.1 hypothetical protein PRUPE_2G095100 [Prunus persica] Length = 112 Score = 57.8 bits (138), Expect = 1e-07 Identities = 26/43 (60%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -1 Query: 587 IPAILSCPPPPRKQ-RPAAVSCKRKLEFFEIVGREEIESFFRS 462 IP +++CPP PRK R AA SCKRKL+FFE ++E+E FFRS Sbjct: 55 IPTVVTCPPAPRKPARRAASSCKRKLQFFETANQDEVEDFFRS 97 >OAY38921.1 hypothetical protein MANES_10G053200 [Manihot esculenta] Length = 118 Score = 57.8 bits (138), Expect = 1e-07 Identities = 29/46 (63%), Positives = 32/46 (69%), Gaps = 4/46 (8%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAAVSCKRKL----EFFEIVGREEIESFFRS 462 IP IL CPP PRK R + CKRKL EFFEIV R+E+ES FRS Sbjct: 57 IPDILCCPPAPRKPRRRMILCKRKLLEFDEFFEIVNRQEVESLFRS 102 >XP_018848069.1 PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like [Juglans regia] Length = 122 Score = 57.4 bits (137), Expect = 2e-07 Identities = 34/63 (53%), Positives = 41/63 (65%), Gaps = 5/63 (7%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAAVSCKRK----LEFFEIVGREEIESFFR-SFCCKGNISMKKRR 423 +P IL CPP PRK R +A SCKRK L+FFEIV REE+++FFR SF I+ K R Sbjct: 58 VPEILVCPPAPRKPR-SAPSCKRKPSVDLQFFEIVNREEVDAFFRSSFENVSGITSVKIR 116 Query: 422 QVC 414 C Sbjct: 117 SCC 119 >KCW87448.1 hypothetical protein EUGRSUZ_B03916 [Eucalyptus grandis] Length = 110 Score = 56.6 bits (135), Expect = 3e-07 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = -1 Query: 587 IPAILSCPPPPRKQRPAAVSCKRKLEFFEIVGREEIESFFRS 462 IP + S PP PRKQ + KRKL FFEI GREE+ESFFRS Sbjct: 49 IPTVRSRPPTPRKQARPVLPHKRKLHFFEITGREEVESFFRS 90