BLASTX nr result
ID: Panax25_contig00025063
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00025063 (749 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM80478.1 hypothetical protein DCAR_032226 [Daucus carota subsp... 62 8e-08 XP_017228812.1 PREDICTED: U3 small nucleolar RNA-associated prot... 62 8e-08 JAT48281.1 Cirhin, partial [Anthurium amnicola] 60 2e-07 XP_017237037.1 PREDICTED: U3 small nucleolar RNA-associated prot... 62 2e-07 XP_010108036.1 hypothetical protein L484_004002 [Morus notabilis... 61 4e-07 KZV54527.1 transducin-related family protein [Dorcoceras hygrome... 60 1e-06 XP_019175279.1 PREDICTED: U3 small nucleolar RNA-associated prot... 60 1e-06 XP_017241782.1 PREDICTED: U3 small nucleolar RNA-associated prot... 60 1e-06 XP_011074343.1 PREDICTED: cirhin [Sesamum indicum] 59 2e-06 CDP01270.1 unnamed protein product [Coffea canephora] 59 3e-06 XP_016468211.1 PREDICTED: U3 small nucleolar RNA-associated prot... 58 4e-06 XP_009800928.1 PREDICTED: cirhin-like [Nicotiana sylvestris] 58 4e-06 XP_019257084.1 PREDICTED: U3 small nucleolar RNA-associated prot... 58 4e-06 XP_016443342.1 PREDICTED: U3 small nucleolar RNA-associated prot... 58 4e-06 XP_009612217.1 PREDICTED: U3 small nucleolar RNA-associated prot... 58 4e-06 XP_016550642.1 PREDICTED: U3 small nucleolar RNA-associated prot... 58 4e-06 XP_010274381.1 PREDICTED: U3 small nucleolar RNA-associated prot... 57 7e-06 XP_018843489.1 PREDICTED: U3 small nucleolar RNA-associated prot... 57 1e-05 XP_018833793.1 PREDICTED: U3 small nucleolar RNA-associated prot... 57 1e-05 >KZM80478.1 hypothetical protein DCAR_032226 [Daucus carota subsp. sativus] Length = 252 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDIS 691 RQHWFISRLDGASVTAGGFTPRNSNIL IS Sbjct: 62 RQHWFISRLDGASVTAGGFTPRNSNILVIS 91 >XP_017228812.1 PREDICTED: U3 small nucleolar RNA-associated protein 4-like [Daucus carota subsp. sativus] Length = 262 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDIS 691 RQHWFISRLDGASVTAGGFTPRNSNIL IS Sbjct: 72 RQHWFISRLDGASVTAGGFTPRNSNILVIS 101 >JAT48281.1 Cirhin, partial [Anthurium amnicola] Length = 221 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = +2 Query: 539 YSICCILFGQMPVVNHLNFWDRQHWFISRLDGASVTAGGFTPRNSNILDIS 691 YS+ I F V + L F+ RQHWFI+RL+GASVTAGGF P NSNIL I+ Sbjct: 11 YSVFRIDFATSKVEDCLKFFCRQHWFIARLNGASVTAGGFPPGNSNILVIT 61 >XP_017237037.1 PREDICTED: U3 small nucleolar RNA-associated protein 4-like [Daucus carota subsp. sativus] KZN04016.1 hypothetical protein DCAR_004814 [Daucus carota subsp. sativus] Length = 861 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDIS 691 RQHWFISRLDGASVTAGGFTPRNSNIL IS Sbjct: 671 RQHWFISRLDGASVTAGGFTPRNSNILVIS 700 >XP_010108036.1 hypothetical protein L484_004002 [Morus notabilis] EXC17682.1 hypothetical protein L484_004002 [Morus notabilis] Length = 1176 Score = 61.2 bits (147), Expect = 4e-07 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = +2 Query: 560 FGQMPVVNHLNFWDRQHWFISRLDGASVTAGGFTPRNSNILDIS 691 FG + V N L W RQHWFISRLDGASVTAGGF+PRN+N+L ++ Sbjct: 973 FGDVYVFN-LEIW-RQHWFISRLDGASVTAGGFSPRNNNVLIVT 1014 >KZV54527.1 transducin-related family protein [Dorcoceras hygrometricum] Length = 817 Score = 59.7 bits (143), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDIS 691 RQHWF+SRLDGASVTAGGFTP+NSNIL IS Sbjct: 631 RQHWFLSRLDGASVTAGGFTPQNSNILIIS 660 >XP_019175279.1 PREDICTED: U3 small nucleolar RNA-associated protein 4-like [Ipomoea nil] Length = 819 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDIS 691 RQHWFISRLDG+SVTAGGFTPRNSN+L +S Sbjct: 627 RQHWFISRLDGSSVTAGGFTPRNSNVLILS 656 >XP_017241782.1 PREDICTED: U3 small nucleolar RNA-associated protein 4 homolog [Daucus carota subsp. sativus] KZN01120.1 hypothetical protein DCAR_009874 [Daucus carota subsp. sativus] Length = 826 Score = 59.7 bits (143), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDIS 691 RQHWFI+RLDGASVTAGGFTPRNSNIL I+ Sbjct: 636 RQHWFIARLDGASVTAGGFTPRNSNILIIA 665 >XP_011074343.1 PREDICTED: cirhin [Sesamum indicum] Length = 819 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDI 688 RQHWFISRLDGASVTAGGFTP+NSNIL I Sbjct: 634 RQHWFISRLDGASVTAGGFTPQNSNILII 662 >CDP01270.1 unnamed protein product [Coffea canephora] Length = 807 Score = 58.5 bits (140), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDIS 691 RQHWFI+RLDGASVTAGGFTPR+SN+L IS Sbjct: 620 RQHWFIARLDGASVTAGGFTPRSSNVLIIS 649 >XP_016468211.1 PREDICTED: U3 small nucleolar RNA-associated protein 4 homolog [Nicotiana tabacum] Length = 817 Score = 58.2 bits (139), Expect = 4e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDIS 691 RQHWFISRL+G+SVTAGGFTPRNSN+L +S Sbjct: 627 RQHWFISRLNGSSVTAGGFTPRNSNVLIVS 656 >XP_009800928.1 PREDICTED: cirhin-like [Nicotiana sylvestris] Length = 817 Score = 58.2 bits (139), Expect = 4e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDIS 691 RQHWFISRL+G+SVTAGGFTPRNSN+L +S Sbjct: 627 RQHWFISRLNGSSVTAGGFTPRNSNVLIVS 656 >XP_019257084.1 PREDICTED: U3 small nucleolar RNA-associated protein 4 homolog [Nicotiana attenuata] OIS96033.1 hypothetical protein A4A49_38977 [Nicotiana attenuata] Length = 818 Score = 58.2 bits (139), Expect = 4e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDIS 691 RQHWFISRL+G+SVTAGGFTPRNSN+L +S Sbjct: 627 RQHWFISRLNGSSVTAGGFTPRNSNVLIVS 656 >XP_016443342.1 PREDICTED: U3 small nucleolar RNA-associated protein 4 homolog [Nicotiana tabacum] Length = 818 Score = 58.2 bits (139), Expect = 4e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDIS 691 RQHWFISRL+G+SVTAGGFTPRNSN+L +S Sbjct: 627 RQHWFISRLNGSSVTAGGFTPRNSNVLIVS 656 >XP_009612217.1 PREDICTED: U3 small nucleolar RNA-associated protein 4 homolog [Nicotiana tomentosiformis] Length = 818 Score = 58.2 bits (139), Expect = 4e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDIS 691 RQHWFISRL+G+SVTAGGFTPRNSN+L +S Sbjct: 627 RQHWFISRLNGSSVTAGGFTPRNSNVLIVS 656 >XP_016550642.1 PREDICTED: U3 small nucleolar RNA-associated protein 4 homolog [Capsicum annuum] Length = 820 Score = 58.2 bits (139), Expect = 4e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDIS 691 RQHWFISRL+G+SVTAGGFTPRNSN+L +S Sbjct: 628 RQHWFISRLNGSSVTAGGFTPRNSNVLIVS 657 >XP_010274381.1 PREDICTED: U3 small nucleolar RNA-associated protein 4 homolog [Nelumbo nucifera] Length = 816 Score = 57.4 bits (137), Expect = 7e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNIL 682 RQHWFISRLDGASVTAGGF PRNSN+L Sbjct: 626 RQHWFISRLDGASVTAGGFPPRNSNVL 652 >XP_018843489.1 PREDICTED: U3 small nucleolar RNA-associated protein 4-like [Juglans regia] Length = 815 Score = 57.0 bits (136), Expect = 1e-05 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDIS 691 RQHWFISRLDGASVTAGGF PRN+N+L I+ Sbjct: 624 RQHWFISRLDGASVTAGGFPPRNNNVLIIT 653 >XP_018833793.1 PREDICTED: U3 small nucleolar RNA-associated protein 4 [Juglans regia] Length = 819 Score = 57.0 bits (136), Expect = 1e-05 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 602 RQHWFISRLDGASVTAGGFTPRNSNILDIS 691 RQHWFISRLDGASVTAGGF PRN+N+L I+ Sbjct: 629 RQHWFISRLDGASVTAGGFPPRNNNVLIIT 658