BLASTX nr result
ID: Panax25_contig00024363
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00024363 (627 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006342868.1 PREDICTED: exocyst complex component EXO84B-like ... 61 2e-07 XP_004235510.1 PREDICTED: exocyst complex component EXO84B [Sola... 61 2e-07 XP_019249361.1 PREDICTED: exocyst complex component EXO84B isofo... 60 3e-07 XP_016436241.1 PREDICTED: exocyst complex component EXO84B-like ... 60 3e-07 XP_016479044.1 PREDICTED: exocyst complex component EXO84B-like ... 60 3e-07 XP_009769784.1 PREDICTED: exocyst complex component EXO84B [Nico... 60 3e-07 XP_009622289.1 PREDICTED: exocyst complex component EXO84B [Nico... 60 3e-07 XP_019249360.1 PREDICTED: exocyst complex component EXO84B isofo... 60 3e-07 XP_016562380.1 PREDICTED: exocyst complex component EXO84B [Caps... 59 1e-06 XP_011072729.1 PREDICTED: exocyst complex component EXO84B-like ... 58 2e-06 XP_011072728.1 PREDICTED: exocyst complex component EXO84B-like ... 58 2e-06 XP_015070275.1 PREDICTED: exocyst complex component EXO84B-like ... 57 6e-06 EPS72316.1 hypothetical protein M569_02440 [Genlisea aurea] 56 9e-06 >XP_006342868.1 PREDICTED: exocyst complex component EXO84B-like [Solanum tuberosum] Length = 772 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +3 Query: 447 PQA*GNLNVFKSDNFDADAFVQSKCHSLNEKGLRLL 554 P+ NLNVFKSDNFDADAFVQSKCHSLNEK +R L Sbjct: 26 PKLEENLNVFKSDNFDADAFVQSKCHSLNEKEIRQL 61 >XP_004235510.1 PREDICTED: exocyst complex component EXO84B [Solanum lycopersicum] Length = 772 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +3 Query: 447 PQA*GNLNVFKSDNFDADAFVQSKCHSLNEKGLRLL 554 P+ NLNVFKSDNFDADAFVQSKCHSLNEK +R L Sbjct: 26 PKLEENLNVFKSDNFDADAFVQSKCHSLNEKEIRQL 61 >XP_019249361.1 PREDICTED: exocyst complex component EXO84B isoform X2 [Nicotiana attenuata] Length = 774 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 462 NLNVFKSDNFDADAFVQSKCHSLNEKGLRLL 554 NLNVFKSDNFDADAFVQSKCHSLNEK +R L Sbjct: 31 NLNVFKSDNFDADAFVQSKCHSLNEKEIRQL 61 >XP_016436241.1 PREDICTED: exocyst complex component EXO84B-like [Nicotiana tabacum] Length = 774 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 462 NLNVFKSDNFDADAFVQSKCHSLNEKGLRLL 554 NLNVFKSDNFDADAFVQSKCHSLNEK +R L Sbjct: 31 NLNVFKSDNFDADAFVQSKCHSLNEKEIRQL 61 >XP_016479044.1 PREDICTED: exocyst complex component EXO84B-like [Nicotiana tabacum] Length = 774 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 462 NLNVFKSDNFDADAFVQSKCHSLNEKGLRLL 554 NLNVFKSDNFDADAFVQSKCHSLNEK +R L Sbjct: 31 NLNVFKSDNFDADAFVQSKCHSLNEKEIRQL 61 >XP_009769784.1 PREDICTED: exocyst complex component EXO84B [Nicotiana sylvestris] Length = 774 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 462 NLNVFKSDNFDADAFVQSKCHSLNEKGLRLL 554 NLNVFKSDNFDADAFVQSKCHSLNEK +R L Sbjct: 31 NLNVFKSDNFDADAFVQSKCHSLNEKEIRQL 61 >XP_009622289.1 PREDICTED: exocyst complex component EXO84B [Nicotiana tomentosiformis] Length = 774 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 462 NLNVFKSDNFDADAFVQSKCHSLNEKGLRLL 554 NLNVFKSDNFDADAFVQSKCHSLNEK +R L Sbjct: 31 NLNVFKSDNFDADAFVQSKCHSLNEKEIRQL 61 >XP_019249360.1 PREDICTED: exocyst complex component EXO84B isoform X1 [Nicotiana attenuata] OIT00086.1 exocyst complex component exo84b [Nicotiana attenuata] Length = 777 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 462 NLNVFKSDNFDADAFVQSKCHSLNEKGLRLL 554 NLNVFKSDNFDADAFVQSKCHSLNEK +R L Sbjct: 31 NLNVFKSDNFDADAFVQSKCHSLNEKEIRQL 61 >XP_016562380.1 PREDICTED: exocyst complex component EXO84B [Capsicum annuum] Length = 772 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 462 NLNVFKSDNFDADAFVQSKCHSLNEKGLRLL 554 NLNVFKSD+FDADAFVQSKCHSLNEK +R L Sbjct: 31 NLNVFKSDHFDADAFVQSKCHSLNEKEIRQL 61 >XP_011072729.1 PREDICTED: exocyst complex component EXO84B-like isoform X2 [Sesamum indicum] Length = 722 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 462 NLNVFKSDNFDADAFVQSKCHSLNEKGLRLL 554 NLNVFKSDNFDADAFV SKCHSLNEK +R L Sbjct: 32 NLNVFKSDNFDADAFVHSKCHSLNEKEIRHL 62 >XP_011072728.1 PREDICTED: exocyst complex component EXO84B-like isoform X1 [Sesamum indicum] Length = 774 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 462 NLNVFKSDNFDADAFVQSKCHSLNEKGLRLL 554 NLNVFKSDNFDADAFV SKCHSLNEK +R L Sbjct: 32 NLNVFKSDNFDADAFVHSKCHSLNEKEIRHL 62 >XP_015070275.1 PREDICTED: exocyst complex component EXO84B-like [Solanum pennellii] Length = 772 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 447 PQA*GNLNVFKSDNFDADAFVQSKCHSLNEKGLRLL 554 P+ NLNVFKSDNFDADAFVQSKC SLNEK +R L Sbjct: 26 PKLEENLNVFKSDNFDADAFVQSKCLSLNEKEIRQL 61 >EPS72316.1 hypothetical protein M569_02440 [Genlisea aurea] Length = 764 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 462 NLNVFKSDNFDADAFVQSKCHSLNEKGLRLL 554 NL+VF+SDNFDADA+VQSKCHSLNEK +R L Sbjct: 33 NLHVFRSDNFDADAYVQSKCHSLNEKEIRQL 63