BLASTX nr result
ID: Panax25_contig00024257
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00024257 (408 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNA25794.1 hypothetical protein SOVF_003670 isoform A [Spinacia ... 64 2e-10 XP_014622047.1 PREDICTED: exocyst complex component SEC3A-like i... 66 2e-10 XP_006595946.2 PREDICTED: exocyst complex component SEC3A-like i... 66 2e-10 KNA03775.1 hypothetical protein SOVF_205820 isoform A [Spinacia ... 67 2e-10 XP_014622046.1 PREDICTED: exocyst complex component SEC3A-like i... 66 2e-10 XP_006595945.2 PREDICTED: exocyst complex component SEC3A-like i... 66 3e-10 JAU97768.1 Exocyst complex component SEC3A, partial [Noccaea cae... 62 3e-10 NP_175187.3 exocyst complex component sec3B [Arabidopsis thalian... 67 3e-10 XP_019070423.1 PREDICTED: exocyst complex component SEC3A-like i... 66 5e-10 XP_015082405.1 PREDICTED: exocyst complex component SEC3A-like i... 66 5e-10 KHN42877.1 Exocyst complex component SEC3A-like protein [Glycine... 65 6e-10 GAU14340.1 hypothetical protein TSUD_309000 [Trifolium subterran... 66 6e-10 KNA25796.1 hypothetical protein SOVF_003670 isoform C [Spinacia ... 66 6e-10 KCW88047.1 hypothetical protein EUGRSUZ_A004732, partial [Eucaly... 65 8e-10 OAP13643.1 hypothetical protein AXX17_AT1G41590 [Arabidopsis tha... 65 8e-10 KNA03776.1 hypothetical protein SOVF_205820 isoform B [Spinacia ... 65 8e-10 XP_009603335.1 PREDICTED: exocyst complex component SEC3A-like [... 65 8e-10 XP_019577229.1 PREDICTED: exocyst complex component SEC3A, parti... 65 8e-10 XP_016514115.1 PREDICTED: exocyst complex component SEC3A-like i... 65 8e-10 KCW88046.1 hypothetical protein EUGRSUZ_A004732, partial [Eucaly... 65 8e-10 >KNA25794.1 hypothetical protein SOVF_003670 isoform A [Spinacia oleracea] Length = 136 Score = 64.3 bits (155), Expect = 2e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 105 SWLKQRGQLKRPDHADLRYKCRTYARLLQHLK 200 S+ QRGQLKRPDHADLRY+CRTYARLLQHLK Sbjct: 71 SYFSQRGQLKRPDHADLRYRCRTYARLLQHLK 102 >XP_014622047.1 PREDICTED: exocyst complex component SEC3A-like isoform X4 [Glycine max] Length = 211 Score = 65.9 bits (159), Expect = 2e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +3 Query: 87 VIFSRISWLKQRGQLKRPDHADLRYKCRTYARLLQHLK 200 ++ S S+ QRGQLKRPDHADLRYKCRTYARLLQHLK Sbjct: 130 LMISDKSYFSQRGQLKRPDHADLRYKCRTYARLLQHLK 167 >XP_006595946.2 PREDICTED: exocyst complex component SEC3A-like isoform X3 [Glycine max] XP_006595947.2 PREDICTED: exocyst complex component SEC3A-like isoform X3 [Glycine max] Length = 215 Score = 65.9 bits (159), Expect = 2e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +3 Query: 87 VIFSRISWLKQRGQLKRPDHADLRYKCRTYARLLQHLK 200 ++ S S+ QRGQLKRPDHADLRYKCRTYARLLQHLK Sbjct: 134 LMISDKSYFSQRGQLKRPDHADLRYKCRTYARLLQHLK 171 >KNA03775.1 hypothetical protein SOVF_205820 isoform A [Spinacia oleracea] Length = 468 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 105 SWLKQRGQLKRPDHADLRYKCRTYARLLQHLKV 203 S+ QRGQLKRPDHADLRYKCRTYARLLQHLKV Sbjct: 410 SYFSQRGQLKRPDHADLRYKCRTYARLLQHLKV 442 >XP_014622046.1 PREDICTED: exocyst complex component SEC3A-like isoform X2 [Glycine max] Length = 242 Score = 65.9 bits (159), Expect = 2e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +3 Query: 87 VIFSRISWLKQRGQLKRPDHADLRYKCRTYARLLQHLK 200 ++ S S+ QRGQLKRPDHADLRYKCRTYARLLQHLK Sbjct: 161 LMISDKSYFSQRGQLKRPDHADLRYKCRTYARLLQHLK 198 >XP_006595945.2 PREDICTED: exocyst complex component SEC3A-like isoform X1 [Glycine max] KRH15272.1 hypothetical protein GLYMA_14G078400 [Glycine max] Length = 247 Score = 65.9 bits (159), Expect = 3e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +3 Query: 87 VIFSRISWLKQRGQLKRPDHADLRYKCRTYARLLQHLK 200 ++ S S+ QRGQLKRPDHADLRYKCRTYARLLQHLK Sbjct: 166 LMISDKSYFSQRGQLKRPDHADLRYKCRTYARLLQHLK 203 >JAU97768.1 Exocyst complex component SEC3A, partial [Noccaea caerulescens] Length = 81 Score = 62.0 bits (149), Expect = 3e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 117 QRGQLKRPDHADLRYKCRTYARLLQHLKV 203 QRGQLKRPDH DLRYKC+TYARLLQHLKV Sbjct: 3 QRGQLKRPDHTDLRYKCKTYARLLQHLKV 31 >NP_175187.3 exocyst complex component sec3B [Arabidopsis thaliana] Q9SX86.1 RecName: Full=Exocyst complex component SEC3B; Short=AtSec3b AAD46030.1 Strong similarity to F16N3.18 from Arabidopsis thalian BAC gb|AC007519 [Arabidopsis thaliana] AEE32186.1 exocyst complex component sec3B [Arabidopsis thaliana] Length = 887 Score = 66.6 bits (161), Expect = 3e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 93 FSRISWLKQRGQLKRPDHADLRYKCRTYARLLQHLK 200 FS S+ QRGQLKRPDHADLRYKCRTYARL+QHLK Sbjct: 405 FSDKSYFSQRGQLKRPDHADLRYKCRTYARLMQHLK 440 >XP_019070423.1 PREDICTED: exocyst complex component SEC3A-like isoform X3 [Solanum lycopersicum] Length = 860 Score = 66.2 bits (160), Expect = 5e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 105 SWLKQRGQLKRPDHADLRYKCRTYARLLQHLKVK 206 S+ QRGQLKRPDHADLRYKCRTYARLLQHLK + Sbjct: 410 SYFSQRGQLKRPDHADLRYKCRTYARLLQHLKAR 443 >XP_015082405.1 PREDICTED: exocyst complex component SEC3A-like isoform X3 [Solanum pennellii] Length = 860 Score = 66.2 bits (160), Expect = 5e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 105 SWLKQRGQLKRPDHADLRYKCRTYARLLQHLKVK 206 S+ QRGQLKRPDHADLRYKCRTYARLLQHLK + Sbjct: 410 SYFSQRGQLKRPDHADLRYKCRTYARLLQHLKAR 443 >KHN42877.1 Exocyst complex component SEC3A-like protein [Glycine soja] Length = 305 Score = 65.5 bits (158), Expect = 6e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 105 SWLKQRGQLKRPDHADLRYKCRTYARLLQHLK 200 S+ QRGQLKRPDHADLRYKCRTYARLLQHLK Sbjct: 139 SYFSQRGQLKRPDHADLRYKCRTYARLLQHLK 170 >GAU14340.1 hypothetical protein TSUD_309000 [Trifolium subterraneum] Length = 585 Score = 65.9 bits (159), Expect = 6e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 105 SWLKQRGQLKRPDHADLRYKCRTYARLLQHLKV 203 S+ QRGQLKRPDH+DLRYKCRTYARLLQHLKV Sbjct: 110 SYFSQRGQLKRPDHSDLRYKCRTYARLLQHLKV 142 >KNA25796.1 hypothetical protein SOVF_003670 isoform C [Spinacia oleracea] Length = 605 Score = 65.9 bits (159), Expect = 6e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 105 SWLKQRGQLKRPDHADLRYKCRTYARLLQHLKV 203 S+ QRGQLKRPDHADLRY+CRTYARLLQHLKV Sbjct: 547 SYFSQRGQLKRPDHADLRYRCRTYARLLQHLKV 579 >KCW88047.1 hypothetical protein EUGRSUZ_A004732, partial [Eucalyptus grandis] Length = 452 Score = 65.5 bits (158), Expect = 8e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 105 SWLKQRGQLKRPDHADLRYKCRTYARLLQHLK 200 S+ QRGQLKRPDHADLRYKCRTYARLLQHLK Sbjct: 39 SYFSQRGQLKRPDHADLRYKCRTYARLLQHLK 70 >OAP13643.1 hypothetical protein AXX17_AT1G41590 [Arabidopsis thaliana] Length = 459 Score = 65.5 bits (158), Expect = 8e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 105 SWLKQRGQLKRPDHADLRYKCRTYARLLQHLK 200 S+ QRGQLKRPDHADLRYKCRTYARLLQHLK Sbjct: 249 SYFSQRGQLKRPDHADLRYKCRTYARLLQHLK 280 >KNA03776.1 hypothetical protein SOVF_205820 isoform B [Spinacia oleracea] Length = 475 Score = 65.5 bits (158), Expect = 8e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 105 SWLKQRGQLKRPDHADLRYKCRTYARLLQHLK 200 S+ QRGQLKRPDHADLRYKCRTYARLLQHLK Sbjct: 410 SYFSQRGQLKRPDHADLRYKCRTYARLLQHLK 441 >XP_009603335.1 PREDICTED: exocyst complex component SEC3A-like [Nicotiana tomentosiformis] Length = 478 Score = 65.5 bits (158), Expect = 8e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 105 SWLKQRGQLKRPDHADLRYKCRTYARLLQHLK 200 S+ QRGQLKRPDHADLRYKCRTYARLLQHLK Sbjct: 410 SYFSQRGQLKRPDHADLRYKCRTYARLLQHLK 441 >XP_019577229.1 PREDICTED: exocyst complex component SEC3A, partial [Rhinolophus sinicus] Length = 486 Score = 65.5 bits (158), Expect = 8e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 105 SWLKQRGQLKRPDHADLRYKCRTYARLLQHLK 200 S+ QRGQLKRPDHADLRYKCRTYARLLQHLK Sbjct: 16 SYFSQRGQLKRPDHADLRYKCRTYARLLQHLK 47 >XP_016514115.1 PREDICTED: exocyst complex component SEC3A-like isoform X1 [Nicotiana tabacum] Length = 489 Score = 65.5 bits (158), Expect = 8e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 105 SWLKQRGQLKRPDHADLRYKCRTYARLLQHLK 200 S+ QRGQLKRPDHADLRYKCRTYARLLQHLK Sbjct: 410 SYFSQRGQLKRPDHADLRYKCRTYARLLQHLK 441 >KCW88046.1 hypothetical protein EUGRSUZ_A004732, partial [Eucalyptus grandis] Length = 516 Score = 65.5 bits (158), Expect = 8e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 105 SWLKQRGQLKRPDHADLRYKCRTYARLLQHLK 200 S+ QRGQLKRPDHADLRYKCRTYARLLQHLK Sbjct: 39 SYFSQRGQLKRPDHADLRYKCRTYARLLQHLK 70