BLASTX nr result
ID: Panax25_contig00024165
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00024165 (490 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010089450.1 Proline-rich receptor-like protein kinase PERK9 [... 88 2e-17 CDP04438.1 unnamed protein product [Coffea canephora] 87 8e-17 XP_006348156.1 PREDICTED: chitin elicitor receptor kinase 1-like... 86 2e-16 XP_011087044.1 PREDICTED: chitin elicitor receptor kinase 1-like... 86 2e-16 EYU33877.1 hypothetical protein MIMGU_mgv1a020123mg [Erythranthe... 86 2e-16 XP_012841623.1 PREDICTED: chitin elicitor receptor kinase 1-like... 86 2e-16 XP_011658694.1 PREDICTED: chitin elicitor receptor kinase 1 [Cuc... 86 2e-16 XP_008455461.1 PREDICTED: chitin elicitor receptor kinase 1 [Cuc... 86 2e-16 XP_009623603.1 PREDICTED: lysM domain receptor-like kinase 3 iso... 80 3e-16 KJB42867.1 hypothetical protein B456_007G171300 [Gossypium raimo... 84 3e-16 XP_009623601.1 PREDICTED: lysM domain receptor-like kinase 3 iso... 80 3e-16 CDP11343.1 unnamed protein product [Coffea canephora] 85 4e-16 XP_011047220.1 PREDICTED: chitin elicitor receptor kinase 1-like... 85 4e-16 XP_019267782.1 PREDICTED: lysM domain receptor-like kinase 3 [Ni... 85 4e-16 XP_016459978.1 PREDICTED: chitin elicitor receptor kinase 1-like... 85 4e-16 XP_009613686.1 PREDICTED: lysM domain receptor-like kinase 3 [Ni... 85 4e-16 XP_019194147.1 PREDICTED: lysM domain receptor-like kinase 3 [Ip... 85 4e-16 OIT05691.1 lysm domain receptor-like kinase 3 [Nicotiana attenuata] 85 4e-16 XP_019169585.1 PREDICTED: chitin elicitor receptor kinase 1-like... 84 5e-16 XP_019169584.1 PREDICTED: lysM domain receptor-like kinase 3 iso... 84 5e-16 >XP_010089450.1 Proline-rich receptor-like protein kinase PERK9 [Morus notabilis] EXB37823.1 Proline-rich receptor-like protein kinase PERK9 [Morus notabilis] Length = 609 Score = 88.2 bits (217), Expect = 2e-17 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQLRPSMRS VVALMTLSSTTE+WD + FYEN GLVNLMSGR Sbjct: 563 CTHENPQLRPSMRSIVVALMTLSSTTEDWDVASFYENHGLVNLMSGR 609 >CDP04438.1 unnamed protein product [Coffea canephora] Length = 634 Score = 86.7 bits (213), Expect = 8e-17 Identities = 41/49 (83%), Positives = 43/49 (87%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR*H 343 CTHENPQLRPSMRS VVALMTLSSTTE+WD YENQGLV+LMSGR H Sbjct: 586 CTHENPQLRPSMRSIVVALMTLSSTTEDWDIGSIYENQGLVHLMSGRQH 634 >XP_006348156.1 PREDICTED: chitin elicitor receptor kinase 1-like [Solanum tuberosum] Length = 617 Score = 85.9 bits (211), Expect = 2e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQLRPSMRS VVALMTLSS+TE+WD FYENQGLV+LMSGR Sbjct: 571 CTHENPQLRPSMRSIVVALMTLSSSTEDWDIGSFYENQGLVHLMSGR 617 >XP_011087044.1 PREDICTED: chitin elicitor receptor kinase 1-like [Sesamum indicum] Length = 622 Score = 85.9 bits (211), Expect = 2e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQLRPSMRS VVALMTLSS+TE+WD FYENQGLV+LMSGR Sbjct: 576 CTHENPQLRPSMRSIVVALMTLSSSTEDWDIGSFYENQGLVHLMSGR 622 >EYU33877.1 hypothetical protein MIMGU_mgv1a020123mg [Erythranthe guttata] Length = 768 Score = 85.9 bits (211), Expect = 2e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQLRPSMRS VVALMTLSS+TE+WD FYENQGLV+LMSGR Sbjct: 722 CTHENPQLRPSMRSIVVALMTLSSSTEDWDIGSFYENQGLVHLMSGR 768 >XP_012841623.1 PREDICTED: chitin elicitor receptor kinase 1-like [Erythranthe guttata] Length = 773 Score = 85.9 bits (211), Expect = 2e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQLRPSMRS VVALMTLSS+TE+WD FYENQGLV+LMSGR Sbjct: 727 CTHENPQLRPSMRSIVVALMTLSSSTEDWDIGSFYENQGLVHLMSGR 773 >XP_011658694.1 PREDICTED: chitin elicitor receptor kinase 1 [Cucumis sativus] KGN43499.1 hypothetical protein Csa_7G041930 [Cucumis sativus] Length = 617 Score = 85.5 bits (210), Expect = 2e-16 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQLRPSMRS VVALMTLSS TE+WD FYENQ LVNLMSGR Sbjct: 571 CTHENPQLRPSMRSIVVALMTLSSATEDWDVGSFYENQALVNLMSGR 617 >XP_008455461.1 PREDICTED: chitin elicitor receptor kinase 1 [Cucumis melo] Length = 617 Score = 85.5 bits (210), Expect = 2e-16 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQLRPSMRS VVALMTLSS TE+WD FYENQ LVNLMSGR Sbjct: 571 CTHENPQLRPSMRSIVVALMTLSSATEDWDVGSFYENQALVNLMSGR 617 >XP_009623603.1 PREDICTED: lysM domain receptor-like kinase 3 isoform X2 [Nicotiana tomentosiformis] Length = 134 Score = 80.1 bits (196), Expect = 3e-16 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENP +RPSMRS VVALMTLSS+TE+WD FY NQGL+NL+SGR Sbjct: 88 CTHENPLIRPSMRSIVVALMTLSSSTEDWDVGSFYGNQGLINLISGR 134 >KJB42867.1 hypothetical protein B456_007G171300 [Gossypium raimondii] Length = 297 Score = 83.6 bits (205), Expect = 3e-16 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CT ENPQLRPSMRS VVALMTLSSTTE+WD FYENQ +VNLMSGR Sbjct: 251 CTQENPQLRPSMRSIVVALMTLSSTTEDWDVGTFYENQAVVNLMSGR 297 >XP_009623601.1 PREDICTED: lysM domain receptor-like kinase 3 isoform X1 [Nicotiana tomentosiformis] Length = 137 Score = 80.1 bits (196), Expect = 3e-16 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENP +RPSMRS VVALMTLSS+TE+WD FY NQGL+NL+SGR Sbjct: 91 CTHENPLIRPSMRSIVVALMTLSSSTEDWDVGSFYGNQGLINLISGR 137 >CDP11343.1 unnamed protein product [Coffea canephora] Length = 608 Score = 84.7 bits (208), Expect = 4e-16 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQLRPSMRS VVALMTLSS+TE+WD FY NQG+VNLMSGR Sbjct: 562 CTHENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYGNQGIVNLMSGR 608 >XP_011047220.1 PREDICTED: chitin elicitor receptor kinase 1-like [Populus euphratica] Length = 614 Score = 84.7 bits (208), Expect = 4e-16 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQ+RPSMRS VVALMTLSS+TE+WD FYENQ LVNLMSGR Sbjct: 568 CTHENPQVRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMSGR 614 >XP_019267782.1 PREDICTED: lysM domain receptor-like kinase 3 [Nicotiana attenuata] Length = 620 Score = 84.7 bits (208), Expect = 4e-16 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQLRPSMRS VVALMTLSS+TE+WD FYENQGLV+LM+GR Sbjct: 574 CTHENPQLRPSMRSIVVALMTLSSSTEDWDIGSFYENQGLVHLMTGR 620 >XP_016459978.1 PREDICTED: chitin elicitor receptor kinase 1-like [Nicotiana tabacum] Length = 621 Score = 84.7 bits (208), Expect = 4e-16 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQLRPSMRS VVALMTLSS+TE+WD FYENQGLV+LM+GR Sbjct: 575 CTHENPQLRPSMRSIVVALMTLSSSTEDWDIGSFYENQGLVHLMTGR 621 >XP_009613686.1 PREDICTED: lysM domain receptor-like kinase 3 [Nicotiana tomentosiformis] Length = 625 Score = 84.7 bits (208), Expect = 4e-16 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQLRPSMRS VVALMTLSS+TE+WD FYENQGLV+LM+GR Sbjct: 579 CTHENPQLRPSMRSIVVALMTLSSSTEDWDIGSFYENQGLVHLMTGR 625 >XP_019194147.1 PREDICTED: lysM domain receptor-like kinase 3 [Ipomoea nil] Length = 628 Score = 84.7 bits (208), Expect = 4e-16 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQ+RPSMRS VVALMTLSS+TE+WD FY NQGL+NLMSGR Sbjct: 582 CTHENPQIRPSMRSIVVALMTLSSSTEDWDVGAFYGNQGLINLMSGR 628 >OIT05691.1 lysm domain receptor-like kinase 3 [Nicotiana attenuata] Length = 1233 Score = 84.7 bits (208), Expect = 4e-16 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQLRPSMRS VVALMTLSS+TE+WD FYENQGLV+LM+GR Sbjct: 645 CTHENPQLRPSMRSIVVALMTLSSSTEDWDIGSFYENQGLVHLMTGR 691 Score = 80.1 bits (196), Expect = 2e-14 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQLRPSMRS VVALMT+SS+T +W+ + FYENQGL +LMSGR Sbjct: 1187 CTHENPQLRPSMRSIVVALMTISSSTADWNIAAFYENQGLAHLMSGR 1233 >XP_019169585.1 PREDICTED: chitin elicitor receptor kinase 1-like isoform X2 [Ipomoea nil] Length = 616 Score = 84.3 bits (207), Expect = 5e-16 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQLRPSMRS VVALMTLSS++E+WD FYENQGLV+LMSGR Sbjct: 570 CTHENPQLRPSMRSIVVALMTLSSSSEDWDIGSFYENQGLVHLMSGR 616 >XP_019169584.1 PREDICTED: lysM domain receptor-like kinase 3 isoform X1 [Ipomoea nil] Length = 626 Score = 84.3 bits (207), Expect = 5e-16 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -2 Query: 489 CTHENPQLRPSMRSTVVALMTLSSTTEEWDASLFYENQGLVNLMSGR 349 CTHENPQLRPSMRS VVALMTLSS++E+WD FYENQGLV+LMSGR Sbjct: 580 CTHENPQLRPSMRSIVVALMTLSSSSEDWDIGSFYENQGLVHLMSGR 626