BLASTX nr result
ID: Panax25_contig00024159
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00024159 (415 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN00403.1 hypothetical protein DCAR_009157 [Daucus carota subsp... 56 1e-07 XP_017238887.1 PREDICTED: CAAX prenyl protease 2 [Daucus carota ... 56 7e-07 >KZN00403.1 hypothetical protein DCAR_009157 [Daucus carota subsp. sativus] Length = 109 Score = 56.2 bits (134), Expect = 1e-07 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -2 Query: 360 GMVGFVWFLLPRTYPYLYN**KR*LCWCWHRYCTW 256 G++GFVW L P TYPYLYN + C CWHRYCTW Sbjct: 75 GLLGFVWLLFPFTYPYLYN-YEIDSCECWHRYCTW 108 >XP_017238887.1 PREDICTED: CAAX prenyl protease 2 [Daucus carota subsp. sativus] Length = 311 Score = 56.2 bits (134), Expect(2) = 7e-07 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -2 Query: 360 GMVGFVWFLLPRTYPYLYN**KR*LCWCWHRYCTW 256 G++GFVW L P TYPYLYN + C CWHRYCTW Sbjct: 277 GLLGFVWLLFPFTYPYLYN-YEIDSCECWHRYCTW 310 Score = 24.3 bits (51), Expect(2) = 7e-07 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 415 VIYS*RTGLLSMTFIAG 365 VIYS RTGL+++ IAG Sbjct: 261 VIYSQRTGLITVASIAG 277