BLASTX nr result
ID: Panax25_contig00024157
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00024157 (485 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN79756.1 hypothetical protein VITISV_030221 [Vitis vinifera] 77 3e-14 XP_010663039.1 PREDICTED: protein ABHD17C isoform X2 [Vitis vini... 76 6e-14 CDP11678.1 unnamed protein product [Coffea canephora] 77 1e-13 CBI33822.3 unnamed protein product, partial [Vitis vinifera] 76 2e-13 XP_010663035.1 PREDICTED: protein ABHD17B isoform X1 [Vitis vini... 76 4e-13 XP_015574489.1 PREDICTED: protein ABHD17B isoform X2 [Ricinus co... 75 4e-13 XP_010110327.1 hypothetical protein L484_003617 [Morus notabilis... 75 7e-13 XP_012080769.1 PREDICTED: alpha/beta hydrolase domain-containing... 75 8e-13 OAY29992.1 hypothetical protein MANES_15G188100 [Manihot esculenta] 75 8e-13 XP_008238163.1 PREDICTED: protein ABHD17B [Prunus mume] 75 8e-13 XP_015574488.1 PREDICTED: protein ABHD17B isoform X1 [Ricinus co... 75 9e-13 XP_015875021.1 PREDICTED: protein ABHD17B [Ziziphus jujuba] XP_0... 75 9e-13 XP_011018483.1 PREDICTED: alpha/beta hydrolase domain-containing... 75 9e-13 XP_008448636.1 PREDICTED: protein ABHD17B [Cucumis melo] 75 9e-13 XP_004146102.1 PREDICTED: alpha/beta hydrolase domain-containing... 75 9e-13 EEF43525.1 Protein bem46, putative [Ricinus communis] 75 9e-13 XP_002297695.2 hypothetical protein POPTR_0001s01920g [Populus t... 75 9e-13 OIW10688.1 hypothetical protein TanjilG_16060 [Lupinus angustifo... 73 1e-12 KDO50321.1 hypothetical protein CISIN_1g0356731mg, partial [Citr... 70 1e-12 XP_017234332.1 PREDICTED: LOW QUALITY PROTEIN: protein ABHD17B-l... 74 1e-12 >CAN79756.1 hypothetical protein VITISV_030221 [Vitis vinifera] Length = 251 Score = 77.4 bits (189), Expect = 3e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIHV 119 AILSGLRVLCHVKFTLCFDIY+N+NKI KVKCPVL IHV Sbjct: 176 AILSGLRVLCHVKFTLCFDIYKNVNKIRKVKCPVLVIHV 214 >XP_010663039.1 PREDICTED: protein ABHD17C isoform X2 [Vitis vinifera] Length = 216 Score = 75.9 bits (185), Expect = 6e-14 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFTLCFDIY+N+NKI KVKCPVL IH Sbjct: 176 AILSGLRVLCHVKFTLCFDIYKNVNKIRKVKCPVLVIH 213 >CDP11678.1 unnamed protein product [Coffea canephora] Length = 377 Score = 77.0 bits (188), Expect = 1e-13 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFTLCFDIYRN+NKI KVKCPVL IH Sbjct: 179 AILSGLRVLCHVKFTLCFDIYRNVNKIRKVKCPVLVIH 216 >CBI33822.3 unnamed protein product, partial [Vitis vinifera] Length = 315 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFTLCFDIY+N+NKI KVKCPVL IH Sbjct: 176 AILSGLRVLCHVKFTLCFDIYKNVNKIRKVKCPVLVIH 213 >XP_010663035.1 PREDICTED: protein ABHD17B isoform X1 [Vitis vinifera] Length = 410 Score = 75.9 bits (185), Expect = 4e-13 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFTLCFDIY+N+NKI KVKCPVL IH Sbjct: 176 AILSGLRVLCHVKFTLCFDIYKNVNKIRKVKCPVLVIH 213 >XP_015574489.1 PREDICTED: protein ABHD17B isoform X2 [Ricinus communis] Length = 279 Score = 74.7 bits (182), Expect = 4e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFT CFDIY+NINKI KVKCPVL IH Sbjct: 79 AILSGLRVLCHVKFTFCFDIYKNINKIRKVKCPVLVIH 116 >XP_010110327.1 hypothetical protein L484_003617 [Morus notabilis] EXC25882.1 hypothetical protein L484_003617 [Morus notabilis] Length = 330 Score = 74.7 bits (182), Expect = 7e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFT CFDIY+NINKI KVKCPVL IH Sbjct: 193 AILSGLRVLCHVKFTFCFDIYKNINKIKKVKCPVLVIH 230 >XP_012080769.1 PREDICTED: alpha/beta hydrolase domain-containing protein 17B [Jatropha curcas] KDP30711.1 hypothetical protein JCGZ_15539 [Jatropha curcas] Length = 364 Score = 74.7 bits (182), Expect = 8e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFT CFDIY+NINKI KVKCPVL IH Sbjct: 177 AILSGLRVLCHVKFTFCFDIYKNINKIQKVKCPVLVIH 214 >OAY29992.1 hypothetical protein MANES_15G188100 [Manihot esculenta] Length = 376 Score = 74.7 bits (182), Expect = 8e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFT CFDIY+NINKI KVKCPVL IH Sbjct: 178 AILSGLRVLCHVKFTFCFDIYKNINKIRKVKCPVLVIH 215 >XP_008238163.1 PREDICTED: protein ABHD17B [Prunus mume] Length = 377 Score = 74.7 bits (182), Expect = 8e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFT CFDIY+NINKI KVKCPVL IH Sbjct: 182 AILSGLRVLCHVKFTFCFDIYKNINKIKKVKCPVLVIH 219 >XP_015574488.1 PREDICTED: protein ABHD17B isoform X1 [Ricinus communis] Length = 382 Score = 74.7 bits (182), Expect = 9e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFT CFDIY+NINKI KVKCPVL IH Sbjct: 182 AILSGLRVLCHVKFTFCFDIYKNINKIRKVKCPVLVIH 219 >XP_015875021.1 PREDICTED: protein ABHD17B [Ziziphus jujuba] XP_015865619.1 PREDICTED: protein ABHD17B-like [Ziziphus jujuba] Length = 384 Score = 74.7 bits (182), Expect = 9e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFT CFDIY+NINKI KVKCPVL IH Sbjct: 181 AILSGLRVLCHVKFTFCFDIYKNINKIKKVKCPVLVIH 218 >XP_011018483.1 PREDICTED: alpha/beta hydrolase domain-containing protein 17B [Populus euphratica] Length = 387 Score = 74.7 bits (182), Expect = 9e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFT CFDIY+NINKI KVKCPVL IH Sbjct: 179 AILSGLRVLCHVKFTFCFDIYKNINKIRKVKCPVLVIH 216 >XP_008448636.1 PREDICTED: protein ABHD17B [Cucumis melo] Length = 390 Score = 74.7 bits (182), Expect = 9e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFT CFDIY+NINKI KVKCPVL IH Sbjct: 178 AILSGLRVLCHVKFTFCFDIYKNINKIKKVKCPVLVIH 215 >XP_004146102.1 PREDICTED: alpha/beta hydrolase domain-containing protein 17B [Cucumis sativus] KGN55718.1 hypothetical protein Csa_3G006780 [Cucumis sativus] Length = 390 Score = 74.7 bits (182), Expect = 9e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFT CFDIY+NINKI KVKCPVL IH Sbjct: 178 AILSGLRVLCHVKFTFCFDIYKNINKIKKVKCPVLVIH 215 >EEF43525.1 Protein bem46, putative [Ricinus communis] Length = 393 Score = 74.7 bits (182), Expect = 9e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFT CFDIY+NINKI KVKCPVL IH Sbjct: 182 AILSGLRVLCHVKFTFCFDIYKNINKIRKVKCPVLVIH 219 >XP_002297695.2 hypothetical protein POPTR_0001s01920g [Populus trichocarpa] EEE82500.2 hypothetical protein POPTR_0001s01920g [Populus trichocarpa] Length = 395 Score = 74.7 bits (182), Expect = 9e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFT CFDIY+NINKI KVKCPVL IH Sbjct: 179 AILSGLRVLCHVKFTFCFDIYKNINKIRKVKCPVLVIH 216 >OIW10688.1 hypothetical protein TanjilG_16060 [Lupinus angustifolius] Length = 220 Score = 72.8 bits (177), Expect = 1e-12 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +3 Query: 6 ILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIHV 119 ILSGLRVLCHV FT CFDIY+NINKI KVKCPVL IHV Sbjct: 181 ILSGLRVLCHVNFTFCFDIYKNINKIKKVKCPVLVIHV 218 >KDO50321.1 hypothetical protein CISIN_1g0356731mg, partial [Citrus sinensis] Length = 107 Score = 70.1 bits (170), Expect = 1e-12 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +3 Query: 6 ILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 ILSGLRVLCHVKFT C DIY+NINKI KVKCPVL IH Sbjct: 71 ILSGLRVLCHVKFTFCCDIYKNINKIKKVKCPVLVIH 107 >XP_017234332.1 PREDICTED: LOW QUALITY PROTEIN: protein ABHD17B-like [Daucus carota subsp. sativus] Length = 277 Score = 73.6 bits (179), Expect = 1e-12 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = +3 Query: 3 AILSGLRVLCHVKFTLCFDIYRNINKICKVKCPVLAIH 116 AILSGLRVLCHVKFTLCFDIYRNINKI KVK PVL IH Sbjct: 178 AILSGLRVLCHVKFTLCFDIYRNINKIRKVKSPVLVIH 215