BLASTX nr result
ID: Panax25_contig00024033
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00024033 (441 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017229511.1 PREDICTED: F-box/LRR-repeat protein 15-like [Dauc... 69 8e-11 XP_017229627.1 PREDICTED: F-box/LRR-repeat protein 15 isoform X2... 69 8e-11 XP_017229626.1 PREDICTED: F-box/LRR-repeat protein 15 isoform X1... 69 8e-11 KZN08158.1 hypothetical protein DCAR_001223 [Daucus carota subsp... 69 8e-11 XP_008377827.1 PREDICTED: F-box/LRR-repeat protein 15 [Malus dom... 62 2e-08 XP_008393589.1 PREDICTED: F-box/LRR-repeat protein 15-like [Malu... 62 3e-08 AKJ26293.1 F-box/LRR-repeat protein 15 [Paeonia lactiflora] 61 4e-08 XP_019188902.1 PREDICTED: F-box/LRR-repeat protein 15 [Ipomoea nil] 60 7e-08 XP_004303464.1 PREDICTED: F-box/LRR-repeat protein 15 [Fragaria ... 60 7e-08 XP_011081602.1 PREDICTED: F-box/LRR-repeat protein 15-like [Sesa... 60 1e-07 XP_009362750.1 PREDICTED: F-box/LRR-repeat protein 15-like [Pyru... 60 1e-07 XP_011102267.1 PREDICTED: F-box/LRR-repeat protein 15-like [Sesa... 60 1e-07 XP_009334679.1 PREDICTED: F-box/LRR-repeat protein 15-like [Pyru... 60 1e-07 KOM48839.1 hypothetical protein LR48_Vigan07g254300 [Vigna angul... 59 2e-07 XP_016485428.1 PREDICTED: F-box/LRR-repeat protein 15-like [Nico... 59 2e-07 XP_019258839.1 PREDICTED: F-box/LRR-repeat protein 15 [Nicotiana... 59 2e-07 XP_016478932.1 PREDICTED: F-box/LRR-repeat protein 15-like [Nico... 59 2e-07 XP_009787302.1 PREDICTED: F-box/LRR-repeat protein 15 [Nicotiana... 59 2e-07 XP_009626177.1 PREDICTED: F-box/LRR-repeat protein 15 [Nicotiana... 59 2e-07 XP_006452999.1 hypothetical protein CICLE_v10007327mg [Citrus cl... 59 2e-07 >XP_017229511.1 PREDICTED: F-box/LRR-repeat protein 15-like [Daucus carota subsp. sativus] Length = 956 Score = 68.9 bits (167), Expect = 8e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSLASI 337 TLDVRFCPKIHPVSMG LRAACP+LKRIFSSLAS+ Sbjct: 922 TLDVRFCPKIHPVSMGRLRAACPSLKRIFSSLASM 956 >XP_017229627.1 PREDICTED: F-box/LRR-repeat protein 15 isoform X2 [Daucus carota subsp. sativus] KZN11723.1 hypothetical protein DCAR_004379 [Daucus carota subsp. sativus] Length = 956 Score = 68.9 bits (167), Expect = 8e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSLASI 337 TLDVRFCPKIHPVSMG LRAACP+LKR+FSSLAS+ Sbjct: 922 TLDVRFCPKIHPVSMGRLRAACPSLKRLFSSLASV 956 >XP_017229626.1 PREDICTED: F-box/LRR-repeat protein 15 isoform X1 [Daucus carota subsp. sativus] Length = 959 Score = 68.9 bits (167), Expect = 8e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSLASI 337 TLDVRFCPKIHPVSMG LRAACP+LKR+FSSLAS+ Sbjct: 925 TLDVRFCPKIHPVSMGRLRAACPSLKRLFSSLASV 959 >KZN08158.1 hypothetical protein DCAR_001223 [Daucus carota subsp. sativus] Length = 959 Score = 68.9 bits (167), Expect = 8e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSLASI 337 TLDVRFCPKIHPVSMG LRAACP+LKRIFSSLAS+ Sbjct: 925 TLDVRFCPKIHPVSMGRLRAACPSLKRIFSSLASM 959 >XP_008377827.1 PREDICTED: F-box/LRR-repeat protein 15 [Malus domestica] Length = 865 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSL 346 TLDVRFCPKI P SMG LRAACPNLKRIFSSL Sbjct: 831 TLDVRFCPKISPTSMGRLRAACPNLKRIFSSL 862 >XP_008393589.1 PREDICTED: F-box/LRR-repeat protein 15-like [Malus domestica] Length = 1005 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSS 349 TLDVRFCPKI P+SMG LRAACPNLKRIFSS Sbjct: 971 TLDVRFCPKISPMSMGKLRAACPNLKRIFSS 1001 >AKJ26293.1 F-box/LRR-repeat protein 15 [Paeonia lactiflora] Length = 1001 Score = 61.2 bits (147), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSLA 343 TLDVRFCPKI P SMG LRAACP+LKRIFSSL+ Sbjct: 967 TLDVRFCPKISPTSMGKLRAACPSLKRIFSSLS 999 >XP_019188902.1 PREDICTED: F-box/LRR-repeat protein 15 [Ipomoea nil] Length = 989 Score = 60.5 bits (145), Expect = 7e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSLA 343 TLDVRFCPKI P+S+G+LRAACP LKRIFSSLA Sbjct: 955 TLDVRFCPKICPLSIGTLRAACPGLKRIFSSLA 987 >XP_004303464.1 PREDICTED: F-box/LRR-repeat protein 15 [Fragaria vesca subsp. vesca] Length = 1009 Score = 60.5 bits (145), Expect = 7e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSLA 343 TLDVRFCPKI P+SMG LRAACP+LKRIFSSL+ Sbjct: 974 TLDVRFCPKICPLSMGRLRAACPSLKRIFSSLS 1006 >XP_011081602.1 PREDICTED: F-box/LRR-repeat protein 15-like [Sesamum indicum] Length = 984 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSLA 343 TLDVRFCPKI P+SM SLR ACP+LKRIFSSLA Sbjct: 950 TLDVRFCPKISPLSMSSLRMACPSLKRIFSSLA 982 >XP_009362750.1 PREDICTED: F-box/LRR-repeat protein 15-like [Pyrus x bretschneideri] Length = 1005 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSL 346 TLDVRFCPKI +SMG LRAACPNLKRIFSSL Sbjct: 971 TLDVRFCPKISTMSMGKLRAACPNLKRIFSSL 1002 >XP_011102267.1 PREDICTED: F-box/LRR-repeat protein 15-like [Sesamum indicum] Length = 970 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSLA 343 TLD+RFCPKI P+SMG +RA CP+LKRIFSSLA Sbjct: 936 TLDIRFCPKISPLSMGMIRAVCPSLKRIFSSLA 968 >XP_009334679.1 PREDICTED: F-box/LRR-repeat protein 15-like [Pyrus x bretschneideri] Length = 1004 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSL 346 TLDVRFCPKI +SMG LRAACPNLKRIFSSL Sbjct: 970 TLDVRFCPKISTMSMGRLRAACPNLKRIFSSL 1001 >KOM48839.1 hypothetical protein LR48_Vigan07g254300 [Vigna angularis] Length = 283 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSLAS 340 TLDVRFCPKI +SMG LRAACP+LKRIFSSL++ Sbjct: 249 TLDVRFCPKISSMSMGRLRAACPSLKRIFSSLSA 282 >XP_016485428.1 PREDICTED: F-box/LRR-repeat protein 15-like [Nicotiana tabacum] Length = 890 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSL 346 TLDVRFCPKI P SMG LRAACP+LKRIFSSL Sbjct: 856 TLDVRFCPKICPPSMGRLRAACPSLKRIFSSL 887 >XP_019258839.1 PREDICTED: F-box/LRR-repeat protein 15 [Nicotiana attenuata] OIT40254.1 f-boxlrr-repeat protein 15 [Nicotiana attenuata] Length = 987 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSL 346 TLDVRFCPKI P SMG LRAACP+LKRIFSSL Sbjct: 953 TLDVRFCPKICPPSMGRLRAACPSLKRIFSSL 984 >XP_016478932.1 PREDICTED: F-box/LRR-repeat protein 15-like [Nicotiana tabacum] Length = 987 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSL 346 TLDVRFCPKI P SMG LRAACP+LKRIFSSL Sbjct: 953 TLDVRFCPKICPPSMGRLRAACPSLKRIFSSL 984 >XP_009787302.1 PREDICTED: F-box/LRR-repeat protein 15 [Nicotiana sylvestris] Length = 987 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSL 346 TLDVRFCPKI P SMG LRAACP+LKRIFSSL Sbjct: 953 TLDVRFCPKICPPSMGRLRAACPSLKRIFSSL 984 >XP_009626177.1 PREDICTED: F-box/LRR-repeat protein 15 [Nicotiana tomentosiformis] Length = 987 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSL 346 TLDVRFCPKI P SMG LRAACP+LKRIFSSL Sbjct: 953 TLDVRFCPKICPPSMGRLRAACPSLKRIFSSL 984 >XP_006452999.1 hypothetical protein CICLE_v10007327mg [Citrus clementina] ESR66239.1 hypothetical protein CICLE_v10007327mg [Citrus clementina] Length = 1024 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 441 TLDVRFCPKIHPVSMGSLRAACPNLKRIFSSLAS 340 TLDVRFCPKI SMGSLRAACP+LKRIFSSL + Sbjct: 990 TLDVRFCPKICSTSMGSLRAACPSLKRIFSSLTT 1023