BLASTX nr result
ID: Panax25_contig00023950
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00023950 (359 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN01827.1 hypothetical protein DCAR_010581 [Daucus carota subsp... 62 5e-09 XP_017237377.1 PREDICTED: AAA-ATPase At2g46620-like [Daucus caro... 62 6e-09 >KZN01827.1 hypothetical protein DCAR_010581 [Daucus carota subsp. sativus] Length = 380 Score = 62.4 bits (150), Expect = 5e-09 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +2 Query: 230 LSSIFTTAALIVGFYFVLRLLSKTSLLPMAQKWWRLLEDTCHV 358 L T+ +IVG YF+LRL+SKTSLL +A+KWWRLLED+CHV Sbjct: 3 LRLFLTSPVVIVGIYFLLRLVSKTSLLFIAKKWWRLLEDSCHV 45 >XP_017237377.1 PREDICTED: AAA-ATPase At2g46620-like [Daucus carota subsp. sativus] Length = 479 Score = 62.4 bits (150), Expect = 6e-09 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +2 Query: 230 LSSIFTTAALIVGFYFVLRLLSKTSLLPMAQKWWRLLEDTCHV 358 L T+ +IVG YF+LRL+SKTSLL +A+KWWRLLED+CHV Sbjct: 3 LRLFLTSPVVIVGIYFLLRLVSKTSLLFIAKKWWRLLEDSCHV 45