BLASTX nr result
ID: Panax25_contig00023945
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00023945 (1488 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV71260.1 Kinesin domain-containing protein [Cephalotus follicu... 66 8e-08 XP_010088100.1 hypothetical protein L484_014846 [Morus notabilis... 65 1e-07 KVH88334.1 Kinesin, motor domain-containing protein [Cynara card... 64 4e-07 XP_018848351.1 PREDICTED: kinesin-1-like isoform X2 [Juglans regia] 64 5e-07 XP_018848350.1 PREDICTED: kinesin-1-like isoform X1 [Juglans regia] 64 5e-07 XP_018848352.1 PREDICTED: kinesin-1-like isoform X3 [Juglans regia] 64 6e-07 XP_018848356.1 PREDICTED: kinesin-1-like [Juglans regia] 63 7e-07 XP_018858036.1 PREDICTED: kinesin-1-like [Juglans regia] 63 7e-07 XP_015886039.1 PREDICTED: kinesin-1 [Ziziphus jujuba] 62 1e-06 KYP43187.1 Kinesin-1, partial [Cajanus cajan] 61 3e-06 KVI01039.1 hypothetical protein Ccrd_020697 [Cynara cardunculus ... 60 4e-06 XP_017441443.1 PREDICTED: kinesin-1-like [Vigna angularis] KOM57... 60 7e-06 KHN33612.1 Kinesin-1 [Glycine soja] 60 9e-06 XP_003541768.1 PREDICTED: kinesin-1-like [Glycine max] KHN19063.... 60 9e-06 >GAV71260.1 Kinesin domain-containing protein [Cephalotus follicularis] Length = 796 Score = 66.2 bits (160), Expect = 8e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -1 Query: 288 MADLSTSEIRTEFEEQKRVVSELHERLGDVEYQINEGEKLRK 163 MADLS+SEIR EFEEQKR +SEL +RL D E Q+NEGE+LRK Sbjct: 386 MADLSSSEIRAEFEEQKRTISELQDRLADAEQQLNEGERLRK 427 >XP_010088100.1 hypothetical protein L484_014846 [Morus notabilis] EXB31419.1 hypothetical protein L484_014846 [Morus notabilis] Length = 782 Score = 65.5 bits (158), Expect = 1e-07 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -1 Query: 288 MADLSTSEIRTEFEEQKRVVSELHERLGDVEYQINEGEKLRK 163 MADLS SE R EFEEQKR++SEL +RL DVE+Q+ EGEKLRK Sbjct: 388 MADLSASETRAEFEEQKRILSELQDRLADVEFQVVEGEKLRK 429 >KVH88334.1 Kinesin, motor domain-containing protein [Cynara cardunculus var. scolymus] Length = 744 Score = 63.9 bits (154), Expect = 4e-07 Identities = 40/82 (48%), Positives = 52/82 (63%), Gaps = 2/82 (2%) Frame = -1 Query: 288 MADLSTSEIRTEFEEQKRVVSELHERLGDVEYQINEGEKLRKINMRPN*T*KSTVKKLCS 109 MADLS+SEIRTE+EEQKR+VSEL +RL D E Q+ EGE+LRK K ++ C Sbjct: 406 MADLSSSEIRTEYEEQKRIVSELQDRLRDSETQLLEGERLRKKLHNTILELKGNIRVFCR 465 Query: 108 LQ--VTCDVPFIHEVSICKDTS 49 ++ + D P E S+C TS Sbjct: 466 VRPLLPDDGPGA-EASVCYPTS 486 >XP_018848351.1 PREDICTED: kinesin-1-like isoform X2 [Juglans regia] Length = 735 Score = 63.5 bits (153), Expect = 5e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 288 MADLSTSEIRTEFEEQKRVVSELHERLGDVEYQINEGEKLRK 163 M DLS SE R E+EEQKR+V ELH+RL D E Q++EGEKLRK Sbjct: 319 MVDLSASETRAEYEEQKRIVQELHDRLADTELQLSEGEKLRK 360 >XP_018848350.1 PREDICTED: kinesin-1-like isoform X1 [Juglans regia] Length = 736 Score = 63.5 bits (153), Expect = 5e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 288 MADLSTSEIRTEFEEQKRVVSELHERLGDVEYQINEGEKLRK 163 M DLS SE R E+EEQKR+V ELH+RL D E Q++EGEKLRK Sbjct: 319 MVDLSASETRAEYEEQKRIVQELHDRLADTELQLSEGEKLRK 360 >XP_018848352.1 PREDICTED: kinesin-1-like isoform X3 [Juglans regia] Length = 803 Score = 63.5 bits (153), Expect = 6e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 288 MADLSTSEIRTEFEEQKRVVSELHERLGDVEYQINEGEKLRK 163 M DLS SE R E+EEQKR+V ELH+RL D E Q++EGEKLRK Sbjct: 387 MVDLSASETRAEYEEQKRIVQELHDRLADTELQLSEGEKLRK 428 >XP_018848356.1 PREDICTED: kinesin-1-like [Juglans regia] Length = 623 Score = 63.2 bits (152), Expect = 7e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 288 MADLSTSEIRTEFEEQKRVVSELHERLGDVEYQINEGEKLRK 163 M DLS SE R E+EEQKR+V ELH+RL D E Q++EGEKLRK Sbjct: 387 MVDLSASETRAEYEEQKRIVRELHDRLADTELQLSEGEKLRK 428 >XP_018858036.1 PREDICTED: kinesin-1-like [Juglans regia] Length = 802 Score = 63.2 bits (152), Expect = 7e-07 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 288 MADLSTSEIRTEFEEQKRVVSELHERLGDVEYQINEGEKLRK 163 M DLS SE R EFEE+KR+V ELH+RL D E+Q++EGEKLRK Sbjct: 387 MTDLSASETRAEFEEKKRIVRELHDRLVDAEFQLSEGEKLRK 428 >XP_015886039.1 PREDICTED: kinesin-1 [Ziziphus jujuba] Length = 804 Score = 62.4 bits (150), Expect = 1e-06 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 288 MADLSTSEIRTEFEEQKRVVSELHERLGDVEYQINEGEKLRK 163 MADLS SE RTE+EEQKR+V EL +RL D E Q+ EGEKLRK Sbjct: 389 MADLSASETRTEYEEQKRIVCELQDRLADTELQVIEGEKLRK 430 >KYP43187.1 Kinesin-1, partial [Cajanus cajan] Length = 783 Score = 61.2 bits (147), Expect = 3e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 288 MADLSTSEIRTEFEEQKRVVSELHERLGDVEYQINEGEKLRK 163 MADLS SE RT FEEQKR++ EL +RL D E+Q+ EGEKLRK Sbjct: 365 MADLSVSETRTVFEEQKRIIRELQDRLADKEFQVVEGEKLRK 406 >KVI01039.1 hypothetical protein Ccrd_020697 [Cynara cardunculus var. scolymus] Length = 463 Score = 60.5 bits (145), Expect = 4e-06 Identities = 32/55 (58%), Positives = 38/55 (69%) Frame = -1 Query: 327 HFMIIYAYYLFL*MADLSTSEIRTEFEEQKRVVSELHERLGDVEYQINEGEKLRK 163 HF+ + L DLS SE RTE+EEQKRVVSEL +RL D E Q+ EGE+LRK Sbjct: 367 HFLYFELDIINLNTTDLSESETRTEYEEQKRVVSELQDRLKDTERQLLEGERLRK 421 >XP_017441443.1 PREDICTED: kinesin-1-like [Vigna angularis] KOM57397.1 hypothetical protein LR48_Vigan11g043000 [Vigna angularis] BAT97844.1 hypothetical protein VIGAN_09141300 [Vigna angularis var. angularis] Length = 786 Score = 60.1 bits (144), Expect = 7e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 285 ADLSTSEIRTEFEEQKRVVSELHERLGDVEYQINEGEKLRK 163 ADLS S+ RT FEEQKR++ LHERL D E+Q+ EGEKLRK Sbjct: 373 ADLSASDTRTMFEEQKRIIQGLHERLADKEFQVVEGEKLRK 413 >KHN33612.1 Kinesin-1 [Glycine soja] Length = 717 Score = 59.7 bits (143), Expect = 9e-06 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -1 Query: 288 MADLSTSEIRTEFEEQKRVVSELHERLGDVEYQINEGEKLRK 163 MADLS SE RT FE+QKR++ EL ERL + E+Q+ EGEKLRK Sbjct: 300 MADLSASETRTVFEDQKRIIRELQERLAEKEFQVIEGEKLRK 341 >XP_003541768.1 PREDICTED: kinesin-1-like [Glycine max] KHN19063.1 Kinesin-1 [Glycine soja] KRH21648.1 hypothetical protein GLYMA_13G251100 [Glycine max] Length = 799 Score = 59.7 bits (143), Expect = 9e-06 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -1 Query: 288 MADLSTSEIRTEFEEQKRVVSELHERLGDVEYQINEGEKLRK 163 MADLS SE RT FE+QKR++ EL ERL + E+Q+ EGEKLRK Sbjct: 382 MADLSASETRTVFEDQKRIICELQERLAEKEFQVIEGEKLRK 423