BLASTX nr result
ID: Panax25_contig00023906
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00023906 (460 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV15147.1 glucuronokinase 1 [Dorcoceras hygrometricum] 74 2e-12 XP_010108846.1 Glucuronokinase 1 [Morus notabilis] EXC20361.1 Gl... 74 2e-12 XP_017975863.1 PREDICTED: glucuronokinase 1 [Theobroma cacao] 73 2e-12 EOY02539.1 Glucuronokinase G [Theobroma cacao] 73 2e-12 KZM90903.1 hypothetical protein DCAR_021732 [Daucus carota subsp... 73 3e-12 XP_017255547.1 PREDICTED: glucuronokinase 1 [Daucus carota subsp... 73 3e-12 XP_010273709.1 PREDICTED: glucuronokinase 1-like [Nelumbo nucifera] 73 3e-12 XP_012840701.1 PREDICTED: glucuronokinase 1-like [Erythranthe gu... 72 6e-12 EPS69261.1 hypothetical protein M569_05505, partial [Genlisea au... 72 7e-12 KHG01453.1 Glucuronokinase 1 -like protein [Gossypium arboreum] 71 9e-12 XP_010550164.1 PREDICTED: glucuronokinase 1-like isoform X2 [Tar... 71 1e-11 KMZ57944.1 Galactokinase [Zostera marina] 71 1e-11 KDO36068.1 hypothetical protein CISIN_1g043436mg, partial [Citru... 71 1e-11 XP_019161721.1 PREDICTED: glucuronokinase 1 isoform X2 [Ipomoea ... 71 1e-11 XP_019161720.1 PREDICTED: glucuronokinase 1 isoform X1 [Ipomoea ... 71 1e-11 CDP04117.1 unnamed protein product [Coffea canephora] 71 1e-11 XP_017608337.1 PREDICTED: glucuronokinase 1-like [Gossypium arbo... 71 1e-11 XP_016672756.1 PREDICTED: glucuronokinase 1-like [Gossypium hirs... 71 1e-11 XP_012483868.1 PREDICTED: glucuronokinase 1-like [Gossypium raim... 71 1e-11 XP_007215588.1 hypothetical protein PRUPE_ppa007623mg [Prunus pe... 71 1e-11 >KZV15147.1 glucuronokinase 1 [Dorcoceras hygrometricum] Length = 358 Score = 73.6 bits (179), Expect = 2e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFYKVRHLIKV+VRP+LILNAEKELGIV Sbjct: 126 SSAIVCAALSCLLDFYKVRHLIKVEVRPQLILNAEKELGIV 166 >XP_010108846.1 Glucuronokinase 1 [Morus notabilis] EXC20361.1 Glucuronokinase 1 [Morus notabilis] Length = 360 Score = 73.6 bits (179), Expect = 2e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFYKVRHLIKV+VRP+LILNAEKELGIV Sbjct: 132 SSAIVCAALSCLLDFYKVRHLIKVEVRPQLILNAEKELGIV 172 >XP_017975863.1 PREDICTED: glucuronokinase 1 [Theobroma cacao] Length = 361 Score = 73.2 bits (178), Expect = 2e-12 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFYKVRHLIKV+VRP LILNAEKELGIV Sbjct: 129 SSAIVCAALSCLLDFYKVRHLIKVEVRPNLILNAEKELGIV 169 >EOY02539.1 Glucuronokinase G [Theobroma cacao] Length = 383 Score = 73.2 bits (178), Expect = 2e-12 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFYKVRHLIKV+VRP LILNAEKELGIV Sbjct: 151 SSAIVCAALSCLLDFYKVRHLIKVEVRPNLILNAEKELGIV 191 >KZM90903.1 hypothetical protein DCAR_021732 [Daucus carota subsp. sativus] Length = 348 Score = 72.8 bits (177), Expect = 3e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFYKV+HLIKVD+RP LILNAEKELGI+ Sbjct: 125 SSAIVCAALSCLLDFYKVKHLIKVDIRPNLILNAEKELGII 165 >XP_017255547.1 PREDICTED: glucuronokinase 1 [Daucus carota subsp. sativus] Length = 350 Score = 72.8 bits (177), Expect = 3e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFYKV+HLIKVD+RP LILNAEKELGI+ Sbjct: 125 SSAIVCAALSCLLDFYKVKHLIKVDIRPNLILNAEKELGII 165 >XP_010273709.1 PREDICTED: glucuronokinase 1-like [Nelumbo nucifera] Length = 366 Score = 72.8 bits (177), Expect = 3e-12 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFYKVRHL+KV+VRP LILNAEKELGIV Sbjct: 135 SSAIVCAALSCLLDFYKVRHLVKVEVRPNLILNAEKELGIV 175 >XP_012840701.1 PREDICTED: glucuronokinase 1-like [Erythranthe guttata] EYU34751.1 hypothetical protein MIMGU_mgv1a008923mg [Erythranthe guttata] Length = 358 Score = 72.0 bits (175), Expect = 6e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFYKVRHLIKV VRP LILNAEKELGIV Sbjct: 127 SSAIVCAALSCLLDFYKVRHLIKVGVRPNLILNAEKELGIV 167 >EPS69261.1 hypothetical protein M569_05505, partial [Genlisea aurea] Length = 343 Score = 71.6 bits (174), Expect = 7e-12 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFY+VRHLIKV+VRP LILNAEKELGIV Sbjct: 119 SSAIVCAALSCLLDFYEVRHLIKVEVRPNLILNAEKELGIV 159 >KHG01453.1 Glucuronokinase 1 -like protein [Gossypium arboreum] Length = 329 Score = 71.2 bits (173), Expect = 9e-12 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFYKVRHLIKV+VRP LIL+AEKELGIV Sbjct: 136 SSAIVCAALSCLLDFYKVRHLIKVEVRPNLILSAEKELGIV 176 >XP_010550164.1 PREDICTED: glucuronokinase 1-like isoform X2 [Tarenaya hassleriana] Length = 295 Score = 70.9 bits (172), Expect = 1e-11 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFY VRHLIKV+VRP L+LNAEKELGIV Sbjct: 66 SSAIVCAALSCLLDFYNVRHLIKVEVRPNLVLNAEKELGIV 106 >KMZ57944.1 Galactokinase [Zostera marina] Length = 352 Score = 71.2 bits (173), Expect = 1e-11 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAAL+CLLDFYKVRHLIKV++RP++ILNAEKELGIV Sbjct: 132 SSAIVCAALNCLLDFYKVRHLIKVEIRPQIILNAEKELGIV 172 >KDO36068.1 hypothetical protein CISIN_1g043436mg, partial [Citrus sinensis] Length = 302 Score = 70.9 bits (172), Expect = 1e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAAL CLLDFYKVRHL+KV++RP LILNAEKELGIV Sbjct: 90 SSAIVCAALDCLLDFYKVRHLVKVEIRPNLILNAEKELGIV 130 >XP_019161721.1 PREDICTED: glucuronokinase 1 isoform X2 [Ipomoea nil] Length = 356 Score = 71.2 bits (173), Expect = 1e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFY VRHLIKV+VRP LILNAEKELGIV Sbjct: 125 SSAIVCAALSCLLDFYNVRHLIKVEVRPNLILNAEKELGIV 165 >XP_019161720.1 PREDICTED: glucuronokinase 1 isoform X1 [Ipomoea nil] Length = 357 Score = 71.2 bits (173), Expect = 1e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFY VRHLIKV+VRP LILNAEKELGIV Sbjct: 126 SSAIVCAALSCLLDFYNVRHLIKVEVRPNLILNAEKELGIV 166 >CDP04117.1 unnamed protein product [Coffea canephora] Length = 357 Score = 71.2 bits (173), Expect = 1e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFY VRHLIKV+VRP LILNAEKELGIV Sbjct: 126 SSAIVCAALSCLLDFYNVRHLIKVEVRPNLILNAEKELGIV 166 >XP_017608337.1 PREDICTED: glucuronokinase 1-like [Gossypium arboreum] Length = 366 Score = 71.2 bits (173), Expect = 1e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFYKVRHLIKV+VRP LIL+AEKELGIV Sbjct: 136 SSAIVCAALSCLLDFYKVRHLIKVEVRPNLILSAEKELGIV 176 >XP_016672756.1 PREDICTED: glucuronokinase 1-like [Gossypium hirsutum] Length = 366 Score = 71.2 bits (173), Expect = 1e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFYKVRHLIKV+VRP LIL+AEKELGIV Sbjct: 136 SSAIVCAALSCLLDFYKVRHLIKVEVRPNLILSAEKELGIV 176 >XP_012483868.1 PREDICTED: glucuronokinase 1-like [Gossypium raimondii] KJB33859.1 hypothetical protein B456_006G034800 [Gossypium raimondii] Length = 366 Score = 71.2 bits (173), Expect = 1e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFYKVRHLIKV+VRP LIL+AEKELGIV Sbjct: 136 SSAIVCAALSCLLDFYKVRHLIKVEVRPNLILSAEKELGIV 176 >XP_007215588.1 hypothetical protein PRUPE_ppa007623mg [Prunus persica] ONI19721.1 hypothetical protein PRUPE_3G293800 [Prunus persica] Length = 361 Score = 70.9 bits (172), Expect = 1e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -2 Query: 321 NSPEVCAALSCLLDFYKVRHLIKVDVRPKLILNAEKELGIV 199 +S VCAALSCLLDFYKVRHLIKV+VRP L+LNAEK+LGIV Sbjct: 131 SSAIVCAALSCLLDFYKVRHLIKVEVRPGLVLNAEKQLGIV 171