BLASTX nr result
ID: Panax25_contig00023777
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00023777 (425 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017236253.1 PREDICTED: pentatricopeptide repeat-containing pr... 167 1e-45 XP_008356673.2 PREDICTED: pentatricopeptide repeat-containing pr... 164 2e-44 XP_008346758.1 PREDICTED: pentatricopeptide repeat-containing pr... 164 3e-44 JAU91092.1 Pentatricopeptide repeat-containing protein, partial ... 153 1e-43 XP_008239656.1 PREDICTED: pentatricopeptide repeat-containing pr... 161 3e-43 XP_007210374.1 hypothetical protein PRUPE_ppa001256mg [Prunus pe... 161 3e-43 XP_009343436.1 PREDICTED: pentatricopeptide repeat-containing pr... 160 4e-43 XP_010112585.1 hypothetical protein L484_010090 [Morus notabilis... 160 5e-43 XP_015879483.1 PREDICTED: pentatricopeptide repeat-containing pr... 151 7e-43 XP_009369368.1 PREDICTED: pentatricopeptide repeat-containing pr... 160 7e-43 XP_010272206.1 PREDICTED: pentatricopeptide repeat-containing pr... 160 7e-43 XP_018831595.1 PREDICTED: pentatricopeptide repeat-containing pr... 160 7e-43 CDX73110.1 BnaC06g35580D [Brassica napus] 152 8e-43 KZV21690.1 pentatricopeptide repeat-containing protein [Dorcocer... 155 4e-42 XP_011071731.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 157 5e-42 XP_012080191.1 PREDICTED: pentatricopeptide repeat-containing pr... 157 5e-42 XP_004299605.1 PREDICTED: pentatricopeptide repeat-containing pr... 157 5e-42 KVI06365.1 Pentatricopeptide repeat-containing protein [Cynara c... 157 6e-42 CDP14888.1 unnamed protein product [Coffea canephora] 157 9e-42 GAV66726.1 PPR domain-containing protein/PPR_1 domain-containing... 157 9e-42 >XP_017236253.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Daucus carota subsp. sativus] XP_017236254.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Daucus carota subsp. sativus] KZN04476.1 hypothetical protein DCAR_005313 [Daucus carota subsp. sativus] Length = 856 Score = 167 bits (424), Expect = 1e-45 Identities = 77/81 (95%), Positives = 80/81 (98%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFRRQML+SGICP RIDIVTGWGRRSRVTGSS+VRQSVQELLNMFQFPF+TENGNSGCFV Sbjct: 776 WFRRQMLVSGICPGRIDIVTGWGRRSRVTGSSLVRQSVQELLNMFQFPFYTENGNSGCFV 835 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGETLNRWLLQSYVERMHLL Sbjct: 836 GCGETLNRWLLQSYVERMHLL 856 >XP_008356673.2 PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Malus domestica] Length = 710 Score = 164 bits (414), Expect = 2e-44 Identities = 75/81 (92%), Positives = 80/81 (98%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFR+QMLMSGICPSRIDIVTGWGRRSRVTGSS+VRQ+VQELLN+F+FPFFTENGNSGCFV Sbjct: 630 WFRQQMLMSGICPSRIDIVTGWGRRSRVTGSSLVRQAVQELLNVFRFPFFTENGNSGCFV 689 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE LNRWLLQSYVERMHLL Sbjct: 690 GCGEPLNRWLLQSYVERMHLL 710 >XP_008346758.1 PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Malus domestica] XP_017180880.1 PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Malus domestica] XP_017180881.1 PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Malus domestica] Length = 874 Score = 164 bits (414), Expect = 3e-44 Identities = 75/81 (92%), Positives = 80/81 (98%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFR+QMLMSGICPSRIDIVTGWGRRSRVTGSS+VRQ+VQELLN+F+FPFFTENGNSGCFV Sbjct: 794 WFRQQMLMSGICPSRIDIVTGWGRRSRVTGSSLVRQAVQELLNVFRFPFFTENGNSGCFV 853 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE LNRWLLQSYVERMHLL Sbjct: 854 GCGEPLNRWLLQSYVERMHLL 874 >JAU91092.1 Pentatricopeptide repeat-containing protein, partial [Noccaea caerulescens] Length = 282 Score = 153 bits (387), Expect = 1e-43 Identities = 69/81 (85%), Positives = 77/81 (95%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFR+QML+SG CPSRIDIVTGWGRRSRVTG+SMVRQ+V+ELLN+F+FPFFTENGNSGCFV Sbjct: 202 WFRKQMLVSGDCPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNVFKFPFFTENGNSGCFV 261 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE L WLL+SYVERMHLL Sbjct: 262 GCGEPLKNWLLESYVERMHLL 282 >XP_008239656.1 PREDICTED: pentatricopeptide repeat-containing protein At1g18900 [Prunus mume] Length = 870 Score = 161 bits (407), Expect = 3e-43 Identities = 73/81 (90%), Positives = 79/81 (97%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFR+QML+SGICPSRIDIVTGWGRRSRVTGSS+VRQ+V+ELLNMF FPFFTENGNSGCFV Sbjct: 790 WFRQQMLISGICPSRIDIVTGWGRRSRVTGSSLVRQAVEELLNMFSFPFFTENGNSGCFV 849 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE LN+WLLQSYVERMHLL Sbjct: 850 GCGEPLNKWLLQSYVERMHLL 870 >XP_007210374.1 hypothetical protein PRUPE_ppa001256mg [Prunus persica] ONI08547.1 hypothetical protein PRUPE_5G184700 [Prunus persica] ONI08548.1 hypothetical protein PRUPE_5G184700 [Prunus persica] ONI08549.1 hypothetical protein PRUPE_5G184700 [Prunus persica] ONI08550.1 hypothetical protein PRUPE_5G184700 [Prunus persica] ONI08551.1 hypothetical protein PRUPE_5G184700 [Prunus persica] Length = 870 Score = 161 bits (407), Expect = 3e-43 Identities = 73/81 (90%), Positives = 79/81 (97%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFR+QML+SGICPSRIDIVTGWGRRSRVTGSS+VRQ+V+ELLNMF FPFFTENGNSGCFV Sbjct: 790 WFRQQMLISGICPSRIDIVTGWGRRSRVTGSSLVRQAVEELLNMFSFPFFTENGNSGCFV 849 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE LN+WLLQSYVERMHLL Sbjct: 850 GCGEPLNKWLLQSYVERMHLL 870 >XP_009343436.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Pyrus x bretschneideri] XP_009343437.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Pyrus x bretschneideri] Length = 862 Score = 160 bits (406), Expect = 4e-43 Identities = 73/81 (90%), Positives = 78/81 (96%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFR+QML+SGICPSRIDIVTGWGRRSRVTGSS+VRQ+VQELLN F FPFFTENGNSGCF+ Sbjct: 782 WFRQQMLISGICPSRIDIVTGWGRRSRVTGSSLVRQAVQELLNAFHFPFFTENGNSGCFI 841 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE LNRWLLQSYVERMHLL Sbjct: 842 GCGEPLNRWLLQSYVERMHLL 862 >XP_010112585.1 hypothetical protein L484_010090 [Morus notabilis] EXC34220.1 hypothetical protein L484_010090 [Morus notabilis] Length = 872 Score = 160 bits (405), Expect = 5e-43 Identities = 73/81 (90%), Positives = 78/81 (96%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFRR+ML+SGICPSRIDIVTGWGRRSRVTG+S+VRQ+VQELL MF FPFFTENGNSGCFV Sbjct: 792 WFRREMLISGICPSRIDIVTGWGRRSRVTGASLVRQAVQELLRMFSFPFFTENGNSGCFV 851 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE LNRWLLQSYVERMHLL Sbjct: 852 GCGEPLNRWLLQSYVERMHLL 872 >XP_015879483.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like, partial [Ziziphus jujuba] Length = 281 Score = 151 bits (382), Expect = 7e-43 Identities = 69/81 (85%), Positives = 76/81 (93%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFR+QML+SGI PSRIDIVTGWGRRSR+TG+S+VRQ+VQ+LL MF FPFFTEN NSGCFV Sbjct: 201 WFRQQMLISGIGPSRIDIVTGWGRRSRITGTSLVRQAVQDLLQMFSFPFFTENSNSGCFV 260 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE LNRWLLQSYVERMHLL Sbjct: 261 GCGEPLNRWLLQSYVERMHLL 281 >XP_009369368.1 PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Pyrus x bretschneideri] XP_009369369.1 PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Pyrus x bretschneideri] XP_009369370.1 PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Pyrus x bretschneideri] Length = 870 Score = 160 bits (404), Expect = 7e-43 Identities = 73/81 (90%), Positives = 79/81 (97%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFR+QML+SGICPSRIDIVTGWGRRSRVTGSS+VRQ+VQELL +F+FPFFTENGNSGCFV Sbjct: 790 WFRQQMLISGICPSRIDIVTGWGRRSRVTGSSLVRQAVQELLKVFRFPFFTENGNSGCFV 849 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE LNRWLLQSYVERMHLL Sbjct: 850 GCGEPLNRWLLQSYVERMHLL 870 >XP_010272206.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Nelumbo nucifera] Length = 880 Score = 160 bits (404), Expect = 7e-43 Identities = 75/81 (92%), Positives = 78/81 (96%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFRRQML SGI PSRIDIVTGWGRRSRVTGSS+VRQSVQELLN+FQFPFFTENGNSGCFV Sbjct: 800 WFRRQMLSSGISPSRIDIVTGWGRRSRVTGSSLVRQSVQELLNIFQFPFFTENGNSGCFV 859 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE L+RWLLQSYVERMHLL Sbjct: 860 GCGEPLSRWLLQSYVERMHLL 880 >XP_018831595.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Juglans regia] XP_018831596.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Juglans regia] XP_018831597.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Juglans regia] XP_018831598.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Juglans regia] XP_018831599.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Juglans regia] Length = 882 Score = 160 bits (404), Expect = 7e-43 Identities = 74/81 (91%), Positives = 78/81 (96%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFRRQML+SGI PSRIDIVTGWGRRSRVTGSS+VRQ+VQELLN+F FPFFTENGNSGCFV Sbjct: 802 WFRRQMLISGIAPSRIDIVTGWGRRSRVTGSSLVRQAVQELLNIFSFPFFTENGNSGCFV 861 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE LNRWLLQSYVERMHLL Sbjct: 862 GCGEPLNRWLLQSYVERMHLL 882 >CDX73110.1 BnaC06g35580D [Brassica napus] Length = 297 Score = 152 bits (383), Expect = 8e-43 Identities = 69/81 (85%), Positives = 75/81 (92%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFR+QML+SG CPSRIDIVTGWGRRSRVTGSSMVRQ+V+ELLN+F FPFFTENGNSGCFV Sbjct: 217 WFRKQMLVSGECPSRIDIVTGWGRRSRVTGSSMVRQAVEELLNVFNFPFFTENGNSGCFV 276 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE L WL +SYVERMHLL Sbjct: 277 GCGEPLKNWLSESYVERMHLL 297 >KZV21690.1 pentatricopeptide repeat-containing protein [Dorcoceras hygrometricum] Length = 538 Score = 155 bits (392), Expect = 4e-42 Identities = 72/81 (88%), Positives = 77/81 (95%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFRRQML+SGI PSRIDI+TGWGRRSRVTG+SMVRQ+VQELL MF FPFFTENGN+GCFV Sbjct: 458 WFRRQMLISGIGPSRIDIITGWGRRSRVTGASMVRQAVQELLEMFCFPFFTENGNTGCFV 517 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE LNRWLLQSYVERMHLL Sbjct: 518 GCGEPLNRWLLQSYVERMHLL 538 >XP_011071731.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g74750-like [Sesamum indicum] Length = 859 Score = 157 bits (398), Expect = 5e-42 Identities = 71/81 (87%), Positives = 79/81 (97%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFRR+ML SGICP+RIDIVTGWGRRSRVTG+S+VRQ+VQELLNMF+FPFFTENGNSGCFV Sbjct: 779 WFRREMLTSGICPTRIDIVTGWGRRSRVTGTSLVRQAVQELLNMFRFPFFTENGNSGCFV 838 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE L++WLLQSYVERMHLL Sbjct: 839 GCGEPLSQWLLQSYVERMHLL 859 >XP_012080191.1 PREDICTED: pentatricopeptide repeat-containing protein At1g18900 [Jatropha curcas] KDP31192.1 hypothetical protein JCGZ_11568 [Jatropha curcas] Length = 872 Score = 157 bits (398), Expect = 5e-42 Identities = 73/81 (90%), Positives = 78/81 (96%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFRRQML+SGI PSRIDIVTGWGRRSRVTGSS+VRQ+VQELL++F FPFFTENGNSGCFV Sbjct: 792 WFRRQMLVSGISPSRIDIVTGWGRRSRVTGSSLVRQAVQELLHIFSFPFFTENGNSGCFV 851 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE LNRWLLQSYVERMHLL Sbjct: 852 GCGEPLNRWLLQSYVERMHLL 872 >XP_004299605.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Fragaria vesca subsp. vesca] Length = 879 Score = 157 bits (398), Expect = 5e-42 Identities = 70/81 (86%), Positives = 79/81 (97%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFR+QML+SG+CP+RIDIVTGWGRRSRVTG+SMVR +VQELL+MF FPFFTENGNSGCFV Sbjct: 799 WFRQQMLISGVCPNRIDIVTGWGRRSRVTGTSMVRHAVQELLHMFSFPFFTENGNSGCFV 858 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE+LNRWLL+SYVERMHLL Sbjct: 859 GCGESLNRWLLESYVERMHLL 879 >KVI06365.1 Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 861 Score = 157 bits (397), Expect = 6e-42 Identities = 71/81 (87%), Positives = 78/81 (96%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFRR+ML SG+CPSRIDIVTGWGRRSRVTGSS+VRQSVQELLN+F FPFFTENGN+GCFV Sbjct: 781 WFRREMLSSGVCPSRIDIVTGWGRRSRVTGSSLVRQSVQELLNIFGFPFFTENGNTGCFV 840 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE L+RWL+QSYVERMHLL Sbjct: 841 GCGEPLSRWLVQSYVERMHLL 861 >CDP14888.1 unnamed protein product [Coffea canephora] Length = 864 Score = 157 bits (396), Expect = 9e-42 Identities = 72/81 (88%), Positives = 77/81 (95%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFRRQML SGICPSRIDIVTGWGRRSRVTGSS+VRQ+VQELLN+F FPF TENGNSGCFV Sbjct: 784 WFRRQMLASGICPSRIDIVTGWGRRSRVTGSSLVRQAVQELLNVFSFPFVTENGNSGCFV 843 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE L+RWL+QSYVERMHLL Sbjct: 844 GCGEPLSRWLVQSYVERMHLL 864 >GAV66726.1 PPR domain-containing protein/PPR_1 domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 873 Score = 157 bits (396), Expect = 9e-42 Identities = 72/81 (88%), Positives = 76/81 (93%) Frame = +1 Query: 1 WFRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFV 180 WFRRQ+L SGI PSRIDIVTGWGRRSRVTGSSMVR +VQELLN+F FPFFTENGNSGCF+ Sbjct: 793 WFRRQLLFSGISPSRIDIVTGWGRRSRVTGSSMVRHAVQELLNIFSFPFFTENGNSGCFI 852 Query: 181 GCGETLNRWLLQSYVERMHLL 243 GCGE LNRWLLQSYVERMHLL Sbjct: 853 GCGEPLNRWLLQSYVERMHLL 873