BLASTX nr result
ID: Panax25_contig00023638
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00023638 (810 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN06533.1 hypothetical protein DCAR_007370 [Daucus carota subsp... 58 1e-07 >KZN06533.1 hypothetical protein DCAR_007370 [Daucus carota subsp. sativus] Length = 76 Score = 57.8 bits (138), Expect = 1e-07 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = +3 Query: 168 FDKETGYNCGEELVVMTGRSLKLVNLNDYSEASANHGHDPRNKIGVGN 311 + + T + GEE+ V GRSLK++ ++DYS+A+ANHGHDPRNK G GN Sbjct: 21 YARNTMFLSGEEVKV--GRSLKMIGVDDYSDATANHGHDPRNKPGGGN 66