BLASTX nr result
ID: Panax25_contig00023477
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00023477 (408 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABK95910.1 unknown [Populus trichocarpa] 69 7e-13 KHN42043.1 Guanine nucleotide-binding protein alpha-2 subunit [G... 70 2e-11 XP_003537397.1 PREDICTED: extra-large guanine nucleotide-binding... 70 2e-11 KRH28539.1 hypothetical protein GLYMA_11G060300 [Glycine max] 70 2e-11 KYP66680.1 Guanine nucleotide-binding protein alpha-2 subunit [C... 69 4e-11 XP_014520730.1 PREDICTED: extra-large guanine nucleotide-binding... 69 4e-11 XP_017427244.1 PREDICTED: extra-large guanine nucleotide-binding... 69 4e-11 XP_007156853.1 hypothetical protein PHAVU_002G023000g [Phaseolus... 69 4e-11 XP_011025656.1 PREDICTED: extra-large guanine nucleotide-binding... 69 8e-11 XP_002310767.2 EXTRA-LARGE G-protein [Populus trichocarpa] EEE91... 69 8e-11 KHN36188.1 Guanine nucleotide-binding protein alpha-2 subunit [G... 68 1e-10 XP_003517269.1 PREDICTED: extra-large guanine nucleotide-binding... 68 1e-10 XP_019176349.1 PREDICTED: extra-large guanine nucleotide-binding... 68 1e-10 XP_019176348.1 PREDICTED: extra-large guanine nucleotide-binding... 68 1e-10 XP_019176346.1 PREDICTED: extra-large guanine nucleotide-binding... 68 1e-10 XP_002306447.2 EXTRA-LARGE G-protein [Populus trichocarpa] EEE93... 68 1e-10 XP_011099244.1 PREDICTED: extra-large guanine nucleotide-binding... 68 1e-10 XP_012079134.1 PREDICTED: extra-large guanine nucleotide-binding... 67 2e-10 OAY33864.1 hypothetical protein MANES_13G131400 [Manihot esculenta] 67 2e-10 XP_019420820.1 PREDICTED: extra-large guanine nucleotide-binding... 67 4e-10 >ABK95910.1 unknown [Populus trichocarpa] Length = 67 Score = 68.6 bits (166), Expect = 7e-13 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYS 102 +LKYA+EILKWDEE+PNFSLSEYSMYSTEASSYS Sbjct: 33 ALKYAKEILKWDEEKPNFSLSEYSMYSTEASSYS 66 >KHN42043.1 Guanine nucleotide-binding protein alpha-2 subunit [Glycine soja] Length = 824 Score = 70.1 bits (170), Expect = 2e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYSH 105 SLKYA+EILKW EERPNFSLSEYSMYSTEASS+SH Sbjct: 790 SLKYAKEILKWSEERPNFSLSEYSMYSTEASSFSH 824 >XP_003537397.1 PREDICTED: extra-large guanine nucleotide-binding protein 1-like [Glycine max] KRH28538.1 hypothetical protein GLYMA_11G060300 [Glycine max] Length = 917 Score = 70.1 bits (170), Expect = 2e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYSH 105 SLKYA+EILKW EERPNFSLSEYSMYSTEASS+SH Sbjct: 883 SLKYAKEILKWSEERPNFSLSEYSMYSTEASSFSH 917 >KRH28539.1 hypothetical protein GLYMA_11G060300 [Glycine max] Length = 918 Score = 70.1 bits (170), Expect = 2e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYSH 105 SLKYA+EILKW EERPNFSLSEYSMYSTEASS+SH Sbjct: 884 SLKYAKEILKWSEERPNFSLSEYSMYSTEASSFSH 918 >KYP66680.1 Guanine nucleotide-binding protein alpha-2 subunit [Cajanus cajan] Length = 872 Score = 69.3 bits (168), Expect = 4e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYSH 105 +LKYA+EILKW+EERPNFSLSEYSMYSTEASS+SH Sbjct: 838 ALKYAKEILKWNEERPNFSLSEYSMYSTEASSFSH 872 >XP_014520730.1 PREDICTED: extra-large guanine nucleotide-binding protein 1-like [Vigna radiata var. radiata] Length = 916 Score = 69.3 bits (168), Expect = 4e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYSH 105 +LKYA+EILKW+EERPNFSLSEYSMYSTEASS+SH Sbjct: 882 ALKYAKEILKWNEERPNFSLSEYSMYSTEASSFSH 916 >XP_017427244.1 PREDICTED: extra-large guanine nucleotide-binding protein 1-like [Vigna angularis] KOM45070.1 hypothetical protein LR48_Vigan06g037600 [Vigna angularis] BAU00164.1 hypothetical protein VIGAN_10173100 [Vigna angularis var. angularis] Length = 916 Score = 69.3 bits (168), Expect = 4e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYSH 105 +LKYA+EILKW+EERPNFSLSEYSMYSTEASS+SH Sbjct: 882 ALKYAKEILKWNEERPNFSLSEYSMYSTEASSFSH 916 >XP_007156853.1 hypothetical protein PHAVU_002G023000g [Phaseolus vulgaris] ESW28847.1 hypothetical protein PHAVU_002G023000g [Phaseolus vulgaris] Length = 919 Score = 69.3 bits (168), Expect = 4e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYSH 105 SLKYA+EILKW++ERPNFSLSEYSMYSTEASS+SH Sbjct: 885 SLKYAKEILKWNDERPNFSLSEYSMYSTEASSFSH 919 >XP_011025656.1 PREDICTED: extra-large guanine nucleotide-binding protein 1 [Populus euphratica] Length = 922 Score = 68.6 bits (166), Expect = 8e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYS 102 +LKYA+EILKWDEE+PNFSLSEYSMYSTEASSYS Sbjct: 888 ALKYAKEILKWDEEKPNFSLSEYSMYSTEASSYS 921 >XP_002310767.2 EXTRA-LARGE G-protein [Populus trichocarpa] EEE91217.2 EXTRA-LARGE G-protein [Populus trichocarpa] Length = 924 Score = 68.6 bits (166), Expect = 8e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYS 102 +LKYA+EILKWDEE+PNFSLSEYSMYSTEASSYS Sbjct: 890 ALKYAKEILKWDEEKPNFSLSEYSMYSTEASSYS 923 >KHN36188.1 Guanine nucleotide-binding protein alpha-2 subunit [Glycine soja] Length = 637 Score = 68.2 bits (165), Expect = 1e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYSH 105 SLKYA+EILKW EERPNFSLSEYSMYSTEASS SH Sbjct: 603 SLKYAKEILKWSEERPNFSLSEYSMYSTEASSCSH 637 >XP_003517269.1 PREDICTED: extra-large guanine nucleotide-binding protein 1-like [Glycine max] KRH76924.1 hypothetical protein GLYMA_01G182000 [Glycine max] Length = 915 Score = 68.2 bits (165), Expect = 1e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYSH 105 SLKYA+EILKW EERPNFSLSEYSMYSTEASS SH Sbjct: 881 SLKYAKEILKWSEERPNFSLSEYSMYSTEASSCSH 915 >XP_019176349.1 PREDICTED: extra-large guanine nucleotide-binding protein 1 isoform X3 [Ipomoea nil] Length = 966 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYSH 105 SLKYAREILKWDEE+PNFS+SEYS YST+ASS+SH Sbjct: 932 SLKYAREILKWDEEKPNFSVSEYSFYSTDASSFSH 966 >XP_019176348.1 PREDICTED: extra-large guanine nucleotide-binding protein 1 isoform X2 [Ipomoea nil] Length = 967 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYSH 105 SLKYAREILKWDEE+PNFS+SEYS YST+ASS+SH Sbjct: 933 SLKYAREILKWDEEKPNFSVSEYSFYSTDASSFSH 967 >XP_019176346.1 PREDICTED: extra-large guanine nucleotide-binding protein 1 isoform X1 [Ipomoea nil] XP_019176347.1 PREDICTED: extra-large guanine nucleotide-binding protein 1 isoform X1 [Ipomoea nil] Length = 972 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYSH 105 SLKYAREILKWDEE+PNFS+SEYS YST+ASS+SH Sbjct: 938 SLKYAREILKWDEEKPNFSVSEYSFYSTDASSFSH 972 >XP_002306447.2 EXTRA-LARGE G-protein [Populus trichocarpa] EEE93443.2 EXTRA-LARGE G-protein [Populus trichocarpa] Length = 886 Score = 67.8 bits (164), Expect = 1e-10 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYS 102 +LKYAREI+KWDEE+PNFSLSEYS+YSTEASSYS Sbjct: 852 ALKYAREIMKWDEEKPNFSLSEYSLYSTEASSYS 885 >XP_011099244.1 PREDICTED: extra-large guanine nucleotide-binding protein 1 [Sesamum indicum] Length = 971 Score = 67.8 bits (164), Expect = 1e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYSH 105 +LKYAREIL WDE+RPNFSLSEYS+YSTEASS+SH Sbjct: 937 ALKYAREILNWDEDRPNFSLSEYSVYSTEASSFSH 971 >XP_012079134.1 PREDICTED: extra-large guanine nucleotide-binding protein 1 [Jatropha curcas] KDP31845.1 hypothetical protein JCGZ_12306 [Jatropha curcas] Length = 925 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYS 102 +LKYAREILKWDEERPNFSLSEYS YSTEASS+S Sbjct: 891 ALKYAREILKWDEERPNFSLSEYSFYSTEASSFS 924 >OAY33864.1 hypothetical protein MANES_13G131400 [Manihot esculenta] Length = 928 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYS 102 +LKYAREILKW+EERPNFSLSEYS YSTEASSYS Sbjct: 894 ALKYAREILKWEEERPNFSLSEYSFYSTEASSYS 927 >XP_019420820.1 PREDICTED: extra-large guanine nucleotide-binding protein 1-like [Lupinus angustifolius] OIV94752.1 hypothetical protein TanjilG_12965 [Lupinus angustifolius] Length = 915 Score = 66.6 bits (161), Expect = 4e-10 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = +1 Query: 1 SLKYAREILKWDEERPNFSLSEYSMYSTEASSYSH 105 +LKYA+EILKW+EERPNFSLS+YSMYSTE SS+SH Sbjct: 881 ALKYAKEILKWNEERPNFSLSQYSMYSTEGSSFSH 915