BLASTX nr result
ID: Panax25_contig00023078
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00023078 (356 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016734712.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 3e-12 KJB83502.1 hypothetical protein B456_013G250400 [Gossypium raimo... 72 3e-12 XP_016734703.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 3e-12 XP_012464230.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 3e-12 XP_017607545.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 1e-11 ONI05277.1 hypothetical protein PRUPE_6G365500 [Prunus persica] 65 9e-10 XP_007205009.1 hypothetical protein PRUPE_ppa003637mg [Prunus pe... 65 9e-10 ONI05276.1 hypothetical protein PRUPE_6G365500 [Prunus persica] 65 9e-10 XP_008218493.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 9e-10 XP_009361557.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 2e-09 XP_008355865.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 2e-09 OMP04804.1 hypothetical protein COLO4_09284 [Corchorus olitorius] 64 2e-09 XP_010242491.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 2e-09 XP_018856638.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 4e-09 XP_009794453.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 6e-09 XP_010646461.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 8e-09 EOY28352.1 Pentatricopeptide repeat-containing protein, putative... 62 1e-08 EOY28351.1 Pentatricopeptide repeat-containing protein, putative... 62 1e-08 XP_009605171.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 1e-08 XP_017978724.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 2e-08 >XP_016734712.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial isoform X2 [Gossypium hirsutum] Length = 471 Score = 71.6 bits (174), Expect = 3e-12 Identities = 38/72 (52%), Positives = 45/72 (62%), Gaps = 2/72 (2%) Frame = +1 Query: 22 SAGLLEDLIFLFFNLKYCTVKPQM--KCNKFGCVPNEDSFYFTIEALCRRSIFHWAGSVC 195 + G+L +LI LF L ++ K FGCVPNEDSFYFTIEALCRRS + W SVC Sbjct: 127 NVGVLNELIALFSKLGKGKAAMEVFDKFADFGCVPNEDSFYFTIEALCRRSFYDWGWSVC 186 Query: 196 EKICGYCELRSG 231 EK+ G L G Sbjct: 187 EKMLGEESLPDG 198 >KJB83502.1 hypothetical protein B456_013G250400 [Gossypium raimondii] Length = 471 Score = 71.6 bits (174), Expect = 3e-12 Identities = 38/72 (52%), Positives = 45/72 (62%), Gaps = 2/72 (2%) Frame = +1 Query: 22 SAGLLEDLIFLFFNLKYCTVKPQM--KCNKFGCVPNEDSFYFTIEALCRRSIFHWAGSVC 195 + G+L +LI LF L ++ K FGCVPNEDSFYFTIEALCRRS + W SVC Sbjct: 127 NVGVLNELIALFSKLGKGKAAMEVFDKFADFGCVPNEDSFYFTIEALCRRSFYDWGWSVC 186 Query: 196 EKICGYCELRSG 231 EK+ G L G Sbjct: 187 EKMLGEESLPDG 198 >XP_016734703.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial isoform X1 [Gossypium hirsutum] Length = 567 Score = 71.6 bits (174), Expect = 3e-12 Identities = 38/72 (52%), Positives = 45/72 (62%), Gaps = 2/72 (2%) Frame = +1 Query: 22 SAGLLEDLIFLFFNLKYCTVKPQM--KCNKFGCVPNEDSFYFTIEALCRRSIFHWAGSVC 195 + G+L +LI LF L ++ K FGCVPNEDSFYFTIEALCRRS + W SVC Sbjct: 223 NVGVLNELIALFSKLGKGKAAMEVFDKFADFGCVPNEDSFYFTIEALCRRSFYDWGWSVC 282 Query: 196 EKICGYCELRSG 231 EK+ G L G Sbjct: 283 EKMLGEESLPDG 294 >XP_012464230.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Gossypium raimondii] KJB83501.1 hypothetical protein B456_013G250400 [Gossypium raimondii] Length = 567 Score = 71.6 bits (174), Expect = 3e-12 Identities = 38/72 (52%), Positives = 45/72 (62%), Gaps = 2/72 (2%) Frame = +1 Query: 22 SAGLLEDLIFLFFNLKYCTVKPQM--KCNKFGCVPNEDSFYFTIEALCRRSIFHWAGSVC 195 + G+L +LI LF L ++ K FGCVPNEDSFYFTIEALCRRS + W SVC Sbjct: 223 NVGVLNELIALFSKLGKGKAAMEVFDKFADFGCVPNEDSFYFTIEALCRRSFYDWGWSVC 282 Query: 196 EKICGYCELRSG 231 EK+ G L G Sbjct: 283 EKMLGEESLPDG 294 >XP_017607545.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Gossypium arboreum] Length = 567 Score = 70.1 bits (170), Expect = 1e-11 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 2/77 (2%) Frame = +1 Query: 7 QEELHSAGLLEDLIFLFFNLKYCTVKPQM--KCNKFGCVPNEDSFYFTIEALCRRSIFHW 180 +E + + G+L +LI LF L ++ K FGCVPNEDSFYFTIEALCRRS + W Sbjct: 218 REGVLNVGVLNELIALFSKLGKGKAAMEVFDKFADFGCVPNEDSFYFTIEALCRRSFYDW 277 Query: 181 AGSVCEKICGYCELRSG 231 SVCEK+ L G Sbjct: 278 GWSVCEKMLSEESLPDG 294 >ONI05277.1 hypothetical protein PRUPE_6G365500 [Prunus persica] Length = 472 Score = 64.7 bits (156), Expect = 9e-10 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 94 KCNKFGCVPNEDSFYFTIEALCRRSIFHWAGSVCEKI 204 K FGCVPN D++YFTIEALCRRSIF WA SVCEK+ Sbjct: 153 KFGDFGCVPNADTYYFTIEALCRRSIFGWAQSVCEKM 189 >XP_007205009.1 hypothetical protein PRUPE_ppa003637mg [Prunus persica] Length = 560 Score = 64.7 bits (156), Expect = 9e-10 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 94 KCNKFGCVPNEDSFYFTIEALCRRSIFHWAGSVCEKI 204 K FGCVPN D++YFTIEALCRRSIF WA SVCEK+ Sbjct: 241 KFGDFGCVPNADTYYFTIEALCRRSIFGWAQSVCEKM 277 >ONI05276.1 hypothetical protein PRUPE_6G365500 [Prunus persica] Length = 576 Score = 64.7 bits (156), Expect = 9e-10 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 94 KCNKFGCVPNEDSFYFTIEALCRRSIFHWAGSVCEKI 204 K FGCVPN D++YFTIEALCRRSIF WA SVCEK+ Sbjct: 257 KFGDFGCVPNADTYYFTIEALCRRSIFGWAQSVCEKM 293 >XP_008218493.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Prunus mume] Length = 576 Score = 64.7 bits (156), Expect = 9e-10 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 94 KCNKFGCVPNEDSFYFTIEALCRRSIFHWAGSVCEKI 204 K FGCVPN D++YFTIEALCRRSIF WA SVCEK+ Sbjct: 257 KFGDFGCVPNADTYYFTIEALCRRSIFGWAQSVCEKM 293 >XP_009361557.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Pyrus x bretschneideri] Length = 540 Score = 63.9 bits (154), Expect = 2e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 106 FGCVPNEDSFYFTIEALCRRSIFHWAGSVCEKI 204 FGCVPN DS+YFTIEALCRRS F WA SVCEK+ Sbjct: 230 FGCVPNADSYYFTIEALCRRSFFDWAQSVCEKM 262 >XP_008355865.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Malus domestica] Length = 540 Score = 63.9 bits (154), Expect = 2e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 106 FGCVPNEDSFYFTIEALCRRSIFHWAGSVCEKI 204 FGCVPN DS+YFTIEALCRRS F WA SVCEK+ Sbjct: 230 FGCVPNADSYYFTIEALCRRSFFDWAQSVCEKM 262 >OMP04804.1 hypothetical protein COLO4_09284 [Corchorus olitorius] Length = 549 Score = 63.9 bits (154), Expect = 2e-09 Identities = 33/68 (48%), Positives = 43/68 (63%), Gaps = 2/68 (2%) Frame = +1 Query: 7 QEELHSAGLLEDLIFLFFNLKY--CTVKPQMKCNKFGCVPNEDSFYFTIEALCRRSIFHW 180 Q + + G L +LI LF L ++ K FG VPN+D+FYFTIEALCRRS + W Sbjct: 207 QNRVLTVGALNELIALFSKLGKGKAAMEVYNKFGDFGIVPNKDTFYFTIEALCRRSCYDW 266 Query: 181 AGSVCEKI 204 A SVCE++ Sbjct: 267 AWSVCERM 274 >XP_010242491.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Nelumbo nucifera] Length = 626 Score = 63.5 bits (153), Expect = 2e-09 Identities = 32/59 (54%), Positives = 40/59 (67%), Gaps = 2/59 (3%) Frame = +1 Query: 34 LEDLIFLFFNLKYCTVKPQM--KCNKFGCVPNEDSFYFTIEALCRRSIFHWAGSVCEKI 204 L +LI LF+ L ++ K +FGC+PN DS+YFTIEALC RS F WA SVCEK+ Sbjct: 286 LNELISLFWKLGKGKAGLEVFNKFEEFGCIPNADSYYFTIEALCCRSFFDWAWSVCEKM 344 >XP_018856638.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Juglans regia] Length = 615 Score = 62.8 bits (151), Expect = 4e-09 Identities = 32/63 (50%), Positives = 39/63 (61%), Gaps = 2/63 (3%) Frame = +1 Query: 22 SAGLLEDLIFLFFNLKYCTVKPQM--KCNKFGCVPNEDSFYFTIEALCRRSIFHWAGSVC 195 + G L DLI LF L ++ FGCVPN D++YFTIEALCRRS F WA +C Sbjct: 277 NVGALNDLIALFSKLGKGKAALEVFNSFEDFGCVPNVDTYYFTIEALCRRSFFDWALCIC 336 Query: 196 EKI 204 EK+ Sbjct: 337 EKM 339 >XP_009794453.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Nicotiana sylvestris] XP_016460069.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Nicotiana tabacum] Length = 598 Score = 62.4 bits (150), Expect = 6e-09 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 3/64 (4%) Frame = +1 Query: 22 SAGLLEDLIFLFFNLKYCTVKPQMKCNKFG---CVPNEDSFYFTIEALCRRSIFHWAGSV 192 SA +L +LI L L ++ NKFG CVPN D++YFTIEALCRRSI+ WA +V Sbjct: 240 SAEILNELIALLSRLGKGKAAFEI-FNKFGELDCVPNADTYYFTIEALCRRSIYDWASTV 298 Query: 193 CEKI 204 CEK+ Sbjct: 299 CEKM 302 >XP_010646461.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Vitis vinifera] Length = 507 Score = 62.0 bits (149), Expect = 8e-09 Identities = 32/63 (50%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = +1 Query: 22 SAGLLEDLIFLFFNLKYCTVKPQM--KCNKFGCVPNEDSFYFTIEALCRRSIFHWAGSVC 195 + G+L +LI F L ++ ++GC PN DS+YFTIEALCRRSIF WA SVC Sbjct: 222 NVGILNELIAQFAKLGKGKAGLEVFNAFGEYGCEPNADSYYFTIEALCRRSIFDWALSVC 281 Query: 196 EKI 204 EK+ Sbjct: 282 EKM 284 >EOY28352.1 Pentatricopeptide repeat-containing protein, putative isoform 2 [Theobroma cacao] Length = 472 Score = 61.6 bits (148), Expect = 1e-08 Identities = 32/63 (50%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = +1 Query: 22 SAGLLEDLIFLFFNLKYCTVKPQM--KCNKFGCVPNEDSFYFTIEALCRRSIFHWAGSVC 195 + +L +LI LF L ++ K FGCVPN ++YFTIEALCRRSI+ WA SVC Sbjct: 127 TVNVLNELIALFSKLGKGKAAMEVFNKFGDFGCVPNIVTYYFTIEALCRRSIYDWAWSVC 186 Query: 196 EKI 204 EK+ Sbjct: 187 EKM 189 >EOY28351.1 Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 569 Score = 61.6 bits (148), Expect = 1e-08 Identities = 32/63 (50%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = +1 Query: 22 SAGLLEDLIFLFFNLKYCTVKPQM--KCNKFGCVPNEDSFYFTIEALCRRSIFHWAGSVC 195 + +L +LI LF L ++ K FGCVPN ++YFTIEALCRRSI+ WA SVC Sbjct: 224 TVNVLNELIALFSKLGKGKAAMEVFNKFGDFGCVPNIVTYYFTIEALCRRSIYDWAWSVC 283 Query: 196 EKI 204 EK+ Sbjct: 284 EKM 286 >XP_009605171.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Nicotiana tomentosiformis] XP_016465648.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Nicotiana tabacum] Length = 601 Score = 61.6 bits (148), Expect = 1e-08 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 3/38 (7%) Frame = +1 Query: 100 NKFG---CVPNEDSFYFTIEALCRRSIFHWAGSVCEKI 204 NKFG CVPN D++YFTIEALCRRSI+ WA +VCEK+ Sbjct: 268 NKFGELDCVPNADTYYFTIEALCRRSIYDWASTVCEKM 305 >XP_017978724.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Theobroma cacao] Length = 569 Score = 60.8 bits (146), Expect = 2e-08 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = +1 Query: 22 SAGLLEDLIFLFFNLKYCTVKPQM--KCNKFGCVPNEDSFYFTIEALCRRSIFHWAGSVC 195 + +L +LI LF L ++ K FGCVPN ++YFTIEALCRRSI+ WA SVC Sbjct: 224 TVNVLNELIALFSKLGKGKAAMEVFNKFGDFGCVPNMVTYYFTIEALCRRSIYDWAWSVC 283 Query: 196 EKI 204 E++ Sbjct: 284 ERM 286