BLASTX nr result
ID: Panax25_contig00022895
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00022895 (368 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017236733.1 PREDICTED: phosphoribosylamine--glycine ligase [D... 74 8e-13 >XP_017236733.1 PREDICTED: phosphoribosylamine--glycine ligase [Daucus carota subsp. sativus] KZN05828.1 hypothetical protein DCAR_006665 [Daucus carota subsp. sativus] Length = 516 Score = 73.6 bits (179), Expect = 8e-13 Identities = 44/79 (55%), Positives = 54/79 (68%), Gaps = 5/79 (6%) Frame = +1 Query: 142 FNIGAPTNFLNRHHRRTPQSF-AAQFSFGKFSSLFNVDPLNFDSSMVNNKSHRDSLRCKS 318 +N+GAPTN L H+RR+ QSF AAQ SFGK+SSLF + L F S + N RD +S Sbjct: 6 YNVGAPTNHLVHHYRRSTQSFAAAQLSFGKYSSLFQMGSLKFQSLIGN---PRDCRPFES 62 Query: 319 SRFFNSV----SSDNGVSE 363 SRFFN+V +SDNGVSE Sbjct: 63 SRFFNTVFNCLASDNGVSE 81