BLASTX nr result
ID: Panax25_contig00022656
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00022656 (442 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017235724.1 PREDICTED: ATP-dependent zinc metalloprotease FTS... 67 5e-10 XP_017235725.1 PREDICTED: ATP-dependent zinc metalloprotease FTS... 64 6e-09 XP_002283273.1 PREDICTED: ATP-dependent zinc metalloprotease FTS... 63 1e-08 XP_018841747.1 PREDICTED: ATP-dependent zinc metalloprotease FTS... 62 2e-08 KCW85527.1 hypothetical protein EUGRSUZ_B02324 [Eucalyptus grandis] 56 2e-06 >XP_017235724.1 PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like isoform X1 [Daucus carota subsp. sativus] KZN06601.1 hypothetical protein DCAR_007438 [Daucus carota subsp. sativus] Length = 812 Score = 66.6 bits (161), Expect = 5e-10 Identities = 45/70 (64%), Positives = 52/70 (74%), Gaps = 4/70 (5%) Frame = +3 Query: 243 MIFSRIGRSLSRS---TKNLISNGRSAFLGESLLGAPVSRLDGSLVSVRGYLAAIGANKN 413 MIFSRIGRSLSRS TK+L++NGR+A +GES+L P S +DG L VR YLA AN N Sbjct: 1 MIFSRIGRSLSRSPRSTKSLLTNGRAALVGESILQGPGS-VDGKLGLVRKYLA---ANGN 56 Query: 414 LA-SKLYLSD 440 LA SK YLSD Sbjct: 57 LAVSKAYLSD 66 >XP_017235725.1 PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like isoform X2 [Daucus carota subsp. sativus] Length = 811 Score = 63.5 bits (153), Expect = 6e-09 Identities = 43/69 (62%), Positives = 51/69 (73%), Gaps = 3/69 (4%) Frame = +3 Query: 243 MIFSRIGRSLSRSTK--NLISNGRSAFLGESLLGAPVSRLDGSLVSVRGYLAAIGANKNL 416 MIFSRIGRSLSRS + +L++NGR+A +GES+L P S +DG L VR YLA AN NL Sbjct: 1 MIFSRIGRSLSRSPRSTSLLTNGRAALVGESILQGPGS-VDGKLGLVRKYLA---ANGNL 56 Query: 417 A-SKLYLSD 440 A SK YLSD Sbjct: 57 AVSKAYLSD 65 >XP_002283273.1 PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Vitis vinifera] CBI16104.3 unnamed protein product, partial [Vitis vinifera] Length = 820 Score = 62.8 bits (151), Expect = 1e-08 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 12/78 (15%) Frame = +3 Query: 243 MIFSRIGRSLSRST----KNLISNG---RSAFLGESLLGAP-----VSRLDGSLVSVRGY 386 MI SR+GRSLSRS+ +N++S G RSAFL E+L AP + +LDG L +RGY Sbjct: 1 MILSRLGRSLSRSSTAKPRNVLSGGNVGRSAFLNEALSRAPHYSTDLGQLDGGLGFLRGY 60 Query: 387 LAAIGANKNLASKLYLSD 440 L +IGA++ K YLSD Sbjct: 61 LTSIGASRGFVGKSYLSD 78 >XP_018841747.1 PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like isoform X1 [Juglans regia] XP_018841748.1 PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like isoform X2 [Juglans regia] Length = 820 Score = 62.0 bits (149), Expect = 2e-08 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 9/75 (12%) Frame = +3 Query: 243 MIFSRIGRSLSRSTKN-----LISNGRSAFLGESLLG----APVSRLDGSLVSVRGYLAA 395 MIFSRIGRSL RS ++ LIS+GR+ +SLL A +SR+DG L VRGY+ + Sbjct: 1 MIFSRIGRSLCRSARSSSQRHLISSGRTVLPNDSLLASTGNACISRVDGGLGLVRGYITS 60 Query: 396 IGANKNLASKLYLSD 440 +GA K L S +LS+ Sbjct: 61 VGAGKQLVSNSFLSN 75 >KCW85527.1 hypothetical protein EUGRSUZ_B02324 [Eucalyptus grandis] Length = 799 Score = 56.2 bits (134), Expect = 2e-06 Identities = 35/65 (53%), Positives = 42/65 (64%) Frame = +3 Query: 243 MIFSRIGRSLSRSTKNLISNGRSAFLGESLLGAPVSRLDGSLVSVRGYLAAIGANKNLAS 422 MIFSRIGRSLSRS+++ R A LG S L + LDG L VR YLA+ GA K ++ Sbjct: 1 MIFSRIGRSLSRSSRS-----RGASLGTSRLDGALGGLDGKLGFVREYLASAGAIKAFSA 55 Query: 423 KLYLS 437 K YLS Sbjct: 56 KSYLS 60